BLASTX nr result
ID: Astragalus23_contig00008829
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00008829 (486 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX83902.1| hypothetical protein L195_g039952, partial [Trifo... 97 2e-22 ref|XP_013464472.1| hypothetical protein MTR_2g072800 [Medicago ... 69 5e-11 >gb|PNX83902.1| hypothetical protein L195_g039952, partial [Trifolium pratense] Length = 159 Score = 97.1 bits (240), Expect = 2e-22 Identities = 46/50 (92%), Positives = 47/50 (94%) Frame = -3 Query: 151 PPLLSLLKEEKNQGSIPRLGCDAHIAVAPGAACLPLLPQLASDSIRHLDY 2 PP+LSLLKEEKNQGSIPRLGCDAHIAV PGAAC PLLPQ ASDSIRHLDY Sbjct: 108 PPVLSLLKEEKNQGSIPRLGCDAHIAVVPGAACPPLLPQPASDSIRHLDY 157 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 413 TSDRMGIREYRKERGFAGPVALQYGEDLTALGITDDEK 300 TS + RKERG+AGPVALQYGEDLTALGIT+D K Sbjct: 64 TSGQTRSNTSRKERGYAGPVALQYGEDLTALGITNDTK 101 >ref|XP_013464472.1| hypothetical protein MTR_2g072800 [Medicago truncatula] gb|KEH38507.1| hypothetical protein MTR_2g072800 [Medicago truncatula] Length = 273 Score = 69.3 bits (168), Expect = 5e-11 Identities = 33/48 (68%), Positives = 39/48 (81%) Frame = -2 Query: 443 EEKTRRVLPSTSDRMGIREYRKERGFAGPVALQYGEDLTALGITDDEK 300 + K R+LPSTSDR GIREY+KERG+ G +ALQYGEDLTAL I D+ K Sbjct: 135 KNKAGRILPSTSDRGGIREYKKERGYGGLLALQYGEDLTALEIDDETK 182