BLASTX nr result
ID: Astragalus23_contig00008337
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00008337 (670 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRG96430.1| hypothetical protein GLYMA_19G210400 [Glycine max] 55 5e-06 >gb|KRG96430.1| hypothetical protein GLYMA_19G210400 [Glycine max] Length = 165 Score = 55.5 bits (132), Expect = 5e-06 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = +1 Query: 4 EFLMRLSTKFRRKPRPEQIASHLVWDVGGEEVGRMVLGDAKQKEL 138 E + L TKF++KPR QIA+HL WDV GEE RMVL A+QKEL Sbjct: 74 EVCIVLLTKFKKKPRAVQIANHLEWDVEGEEAERMVLVGAQQKEL 118