BLASTX nr result
ID: Astragalus23_contig00007248
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00007248 (343 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_016180764.1| serine/arginine-rich splicing factor SR34A i... 171 2e-51 ref|XP_015944742.1| serine/arginine-rich splicing factor SR34A [... 171 2e-51 ref|XP_018832448.1| PREDICTED: serine/arginine-rich splicing fac... 165 5e-51 ref|XP_011003268.1| PREDICTED: serine/arginine-rich splicing fac... 168 6e-51 ref|XP_006581683.1| PREDICTED: serine/arginine-rich splicing fac... 171 6e-51 ref|XP_003526756.1| PREDICTED: serine/arginine-rich splicing fac... 171 6e-51 ref|XP_006577814.1| PREDICTED: uncharacterized protein LOC100786... 171 6e-51 ref|XP_006577812.1| PREDICTED: uncharacterized protein LOC100786... 171 6e-51 gb|ACU24484.1| unknown [Glycine max] 171 6e-51 ref|NP_001242110.1| uncharacterized protein LOC100786491 [Glycin... 171 6e-51 ref|XP_020212325.1| serine/arginine-rich splicing factor SR34A i... 170 7e-51 ref|XP_020212323.1| serine/arginine-rich splicing factor SR34A i... 170 8e-51 gb|KYP69854.1| Pre-mRNA-splicing factor SF2 [Cajanus cajan] 170 8e-51 ref|XP_017422684.1| PREDICTED: serine/arginine-rich splicing fac... 170 8e-51 dbj|BAT78910.1| hypothetical protein VIGAN_02166800 [Vigna angul... 170 1e-50 ref|XP_007136445.1| hypothetical protein PHAVU_009G046000g [Phas... 170 1e-50 ref|XP_006581678.1| PREDICTED: serine/arginine-rich splicing fac... 171 2e-50 ref|XP_017604884.1| PREDICTED: serine/arginine-rich splicing fac... 164 2e-50 ref|XP_018810941.1| PREDICTED: serine/arginine-rich splicing fac... 169 3e-50 gb|PNX94652.1| pre-mRNA-splicing factor sf2-like protein [Trifol... 168 3e-50 >ref|XP_016180764.1| serine/arginine-rich splicing factor SR34A isoform X2 [Arachis ipaensis] Length = 257 Score = 171 bits (434), Expect = 2e-51 Identities = 79/81 (97%), Positives = 81/81 (100%) Frame = +2 Query: 47 MSGRFSRTIYVGNLPADIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAEE 226 MSGRFSRTIYVGNLP+DIRESEIEDLFYKYGRIMDIELK+PPRPPCYCFVEFDNARDAEE Sbjct: 1 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKIPPRPPCYCFVEFDNARDAEE 60 Query: 227 AIRGRDGYNFDGCRLRVELAH 289 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >ref|XP_015944742.1| serine/arginine-rich splicing factor SR34A [Arachis duranensis] ref|XP_016180762.1| serine/arginine-rich splicing factor SR34A isoform X1 [Arachis ipaensis] ref|XP_016180763.1| serine/arginine-rich splicing factor SR34A isoform X1 [Arachis ipaensis] ref|XP_020968755.1| serine/arginine-rich splicing factor SR34A isoform X1 [Arachis ipaensis] Length = 258 Score = 171 bits (434), Expect = 2e-51 Identities = 79/81 (97%), Positives = 81/81 (100%) Frame = +2 Query: 47 MSGRFSRTIYVGNLPADIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAEE 226 MSGRFSRTIYVGNLP+DIRESEIEDLFYKYGRIMDIELK+PPRPPCYCFVEFDNARDAEE Sbjct: 1 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKIPPRPPCYCFVEFDNARDAEE 60 Query: 227 AIRGRDGYNFDGCRLRVELAH 289 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >ref|XP_018832448.1| PREDICTED: serine/arginine-rich splicing factor SR34A-like, partial [Juglans regia] Length = 96 Score = 165 bits (418), Expect = 5e-51 Identities = 75/81 (92%), Positives = 80/81 (98%) Frame = +2 Query: 47 MSGRFSRTIYVGNLPADIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAEE 226 MSGRFSR+IYVGNLPADIRESEIEDLFYKYGRI+DIELK+PPRPPCYCFVEFD+ RDAE+ Sbjct: 1 MSGRFSRSIYVGNLPADIRESEIEDLFYKYGRILDIELKIPPRPPCYCFVEFDSTRDAED 60 Query: 227 AIRGRDGYNFDGCRLRVELAH 289 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >ref|XP_011003268.1| PREDICTED: serine/arginine-rich splicing factor SR34A isoform X3 [Populus euphratica] Length = 191 Score = 168 bits (426), Expect = 6e-51 Identities = 76/81 (93%), Positives = 81/81 (100%) Frame = +2 Query: 47 MSGRFSRTIYVGNLPADIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAEE 226 MSGRFSRTIYVGNLPADIRESEIEDLFYKYGRI+D+ELK+PPRPPCYCFVEF+NARDAE+ Sbjct: 1 MSGRFSRTIYVGNLPADIRESEIEDLFYKYGRILDVELKIPPRPPCYCFVEFENARDAED 60 Query: 227 AIRGRDGYNFDGCRLRVELAH 289 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >ref|XP_006581683.1| PREDICTED: serine/arginine-rich splicing factor SR34A-like isoform X3 [Glycine max] Length = 262 Score = 171 bits (432), Expect = 6e-51 Identities = 79/81 (97%), Positives = 81/81 (100%) Frame = +2 Query: 47 MSGRFSRTIYVGNLPADIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAEE 226 MSGRFSRTIYVGNLP+DIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAE+ Sbjct: 1 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAED 60 Query: 227 AIRGRDGYNFDGCRLRVELAH 289 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >ref|XP_003526756.1| PREDICTED: serine/arginine-rich splicing factor SR34A-like isoform X2 [Glycine max] gb|KRH53616.1| hypothetical protein GLYMA_06G135500 [Glycine max] Length = 263 Score = 171 bits (432), Expect = 6e-51 Identities = 79/81 (97%), Positives = 81/81 (100%) Frame = +2 Query: 47 MSGRFSRTIYVGNLPADIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAEE 226 MSGRFSRTIYVGNLP+DIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAE+ Sbjct: 1 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAED 60 Query: 227 AIRGRDGYNFDGCRLRVELAH 289 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >ref|XP_006577814.1| PREDICTED: uncharacterized protein LOC100786491 isoform X2 [Glycine max] Length = 266 Score = 171 bits (432), Expect = 6e-51 Identities = 79/81 (97%), Positives = 81/81 (100%) Frame = +2 Query: 47 MSGRFSRTIYVGNLPADIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAEE 226 MSGRFSRTIYVGNLP+DIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAE+ Sbjct: 1 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAED 60 Query: 227 AIRGRDGYNFDGCRLRVELAH 289 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >ref|XP_006577812.1| PREDICTED: uncharacterized protein LOC100786491 isoform X1 [Glycine max] ref|XP_006577813.1| PREDICTED: uncharacterized protein LOC100786491 isoform X1 [Glycine max] gb|KHN19555.1| Pre-mRNA-splicing factor SF2 [Glycine soja] gb|KRH64312.1| hypothetical protein GLYMA_04G229300 [Glycine max] Length = 267 Score = 171 bits (432), Expect = 6e-51 Identities = 79/81 (97%), Positives = 81/81 (100%) Frame = +2 Query: 47 MSGRFSRTIYVGNLPADIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAEE 226 MSGRFSRTIYVGNLP+DIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAE+ Sbjct: 1 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAED 60 Query: 227 AIRGRDGYNFDGCRLRVELAH 289 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >gb|ACU24484.1| unknown [Glycine max] Length = 267 Score = 171 bits (432), Expect = 6e-51 Identities = 79/81 (97%), Positives = 81/81 (100%) Frame = +2 Query: 47 MSGRFSRTIYVGNLPADIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAEE 226 MSGRFSRTIYVGNLP+DIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAE+ Sbjct: 1 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAED 60 Query: 227 AIRGRDGYNFDGCRLRVELAH 289 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >ref|NP_001242110.1| uncharacterized protein LOC100786491 [Glycine max] gb|ACU18725.1| unknown [Glycine max] Length = 267 Score = 171 bits (432), Expect = 6e-51 Identities = 79/81 (97%), Positives = 81/81 (100%) Frame = +2 Query: 47 MSGRFSRTIYVGNLPADIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAEE 226 MSGRFSRTIYVGNLP+DIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAE+ Sbjct: 1 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAED 60 Query: 227 AIRGRDGYNFDGCRLRVELAH 289 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >ref|XP_020212325.1| serine/arginine-rich splicing factor SR34A isoform X2 [Cajanus cajan] Length = 259 Score = 170 bits (431), Expect = 7e-51 Identities = 78/81 (96%), Positives = 81/81 (100%) Frame = +2 Query: 47 MSGRFSRTIYVGNLPADIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAEE 226 MSGRFSRTIYVGNLP+DIRESEIEDLFYKYGRIMDIELK+PPRPPCYCFVEFDNARDAE+ Sbjct: 1 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKIPPRPPCYCFVEFDNARDAED 60 Query: 227 AIRGRDGYNFDGCRLRVELAH 289 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >ref|XP_020212323.1| serine/arginine-rich splicing factor SR34A isoform X1 [Cajanus cajan] ref|XP_020212324.1| serine/arginine-rich splicing factor SR34A isoform X1 [Cajanus cajan] Length = 260 Score = 170 bits (431), Expect = 8e-51 Identities = 78/81 (96%), Positives = 81/81 (100%) Frame = +2 Query: 47 MSGRFSRTIYVGNLPADIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAEE 226 MSGRFSRTIYVGNLP+DIRESEIEDLFYKYGRIMDIELK+PPRPPCYCFVEFDNARDAE+ Sbjct: 1 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKIPPRPPCYCFVEFDNARDAED 60 Query: 227 AIRGRDGYNFDGCRLRVELAH 289 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >gb|KYP69854.1| Pre-mRNA-splicing factor SF2 [Cajanus cajan] Length = 261 Score = 170 bits (431), Expect = 8e-51 Identities = 78/81 (96%), Positives = 81/81 (100%) Frame = +2 Query: 47 MSGRFSRTIYVGNLPADIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAEE 226 MSGRFSRTIYVGNLP+DIRESEIEDLFYKYGRIMDIELK+PPRPPCYCFVEFDNARDAE+ Sbjct: 1 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKIPPRPPCYCFVEFDNARDAED 60 Query: 227 AIRGRDGYNFDGCRLRVELAH 289 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >ref|XP_017422684.1| PREDICTED: serine/arginine-rich splicing factor SR34A [Vigna angularis] ref|XP_017422685.1| PREDICTED: serine/arginine-rich splicing factor SR34A [Vigna angularis] ref|XP_017422686.1| PREDICTED: serine/arginine-rich splicing factor SR34A [Vigna angularis] ref|XP_017422687.1| PREDICTED: serine/arginine-rich splicing factor SR34A [Vigna angularis] Length = 263 Score = 170 bits (431), Expect = 8e-51 Identities = 78/81 (96%), Positives = 81/81 (100%) Frame = +2 Query: 47 MSGRFSRTIYVGNLPADIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAEE 226 MSGRFSRTIYVGNLP+DIRESEIEDLFYKYGRIMDIELK+PPRPPCYCFVEFDNARDAE+ Sbjct: 1 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKIPPRPPCYCFVEFDNARDAED 60 Query: 227 AIRGRDGYNFDGCRLRVELAH 289 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >dbj|BAT78910.1| hypothetical protein VIGAN_02166800 [Vigna angularis var. angularis] Length = 269 Score = 170 bits (431), Expect = 1e-50 Identities = 78/81 (96%), Positives = 81/81 (100%) Frame = +2 Query: 47 MSGRFSRTIYVGNLPADIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAEE 226 MSGRFSRTIYVGNLP+DIRESEIEDLFYKYGRIMDIELK+PPRPPCYCFVEFDNARDAE+ Sbjct: 1 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKIPPRPPCYCFVEFDNARDAED 60 Query: 227 AIRGRDGYNFDGCRLRVELAH 289 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >ref|XP_007136445.1| hypothetical protein PHAVU_009G046000g [Phaseolus vulgaris] ref|XP_007136446.1| hypothetical protein PHAVU_009G046000g [Phaseolus vulgaris] gb|ESW08439.1| hypothetical protein PHAVU_009G046000g [Phaseolus vulgaris] gb|ESW08440.1| hypothetical protein PHAVU_009G046000g [Phaseolus vulgaris] Length = 260 Score = 170 bits (430), Expect = 1e-50 Identities = 77/81 (95%), Positives = 81/81 (100%) Frame = +2 Query: 47 MSGRFSRTIYVGNLPADIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAEE 226 MSGRFSRTIYVGNLP+DIRESEIEDLFYKYGR+MDIELK+PPRPPCYCFVEFDNARDAE+ Sbjct: 1 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRVMDIELKIPPRPPCYCFVEFDNARDAED 60 Query: 227 AIRGRDGYNFDGCRLRVELAH 289 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >ref|XP_006581678.1| PREDICTED: serine/arginine-rich splicing factor SR34A-like isoform X1 [Glycine max] ref|XP_006581679.1| PREDICTED: serine/arginine-rich splicing factor SR34A-like isoform X1 [Glycine max] ref|XP_006581681.1| PREDICTED: serine/arginine-rich splicing factor SR34A-like isoform X1 [Glycine max] Length = 300 Score = 171 bits (432), Expect = 2e-50 Identities = 79/81 (97%), Positives = 81/81 (100%) Frame = +2 Query: 47 MSGRFSRTIYVGNLPADIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAEE 226 MSGRFSRTIYVGNLP+DIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAE+ Sbjct: 1 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAED 60 Query: 227 AIRGRDGYNFDGCRLRVELAH 289 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >ref|XP_017604884.1| PREDICTED: serine/arginine-rich splicing factor SR34A-like [Gossypium arboreum] Length = 109 Score = 164 bits (415), Expect = 2e-50 Identities = 74/81 (91%), Positives = 79/81 (97%) Frame = +2 Query: 47 MSGRFSRTIYVGNLPADIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAEE 226 MSGRFSRTIYVGNLP+DIRE E+EDLFYKYGRI+DIELK+PPRPPCYCFVEFDN+RDAE Sbjct: 1 MSGRFSRTIYVGNLPSDIREWEVEDLFYKYGRILDIELKIPPRPPCYCFVEFDNSRDAEN 60 Query: 227 AIRGRDGYNFDGCRLRVELAH 289 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >ref|XP_018810941.1| PREDICTED: serine/arginine-rich splicing factor SR34A-like [Juglans regia] ref|XP_018810942.1| PREDICTED: serine/arginine-rich splicing factor SR34A-like [Juglans regia] ref|XP_018810943.1| PREDICTED: serine/arginine-rich splicing factor SR34A-like [Juglans regia] ref|XP_018810944.1| PREDICTED: serine/arginine-rich splicing factor SR34A-like [Juglans regia] Length = 266 Score = 169 bits (428), Expect = 3e-50 Identities = 77/81 (95%), Positives = 81/81 (100%) Frame = +2 Query: 47 MSGRFSRTIYVGNLPADIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDNARDAEE 226 MSGRFSRTIYVGNLP+DIRESEIEDLFYKYGRI+DIELK+PPRPPCYCFVEFDNARDAE+ Sbjct: 1 MSGRFSRTIYVGNLPSDIRESEIEDLFYKYGRILDIELKIPPRPPCYCFVEFDNARDAED 60 Query: 227 AIRGRDGYNFDGCRLRVELAH 289 AIRGRDGYNFDGCRLRVELAH Sbjct: 61 AIRGRDGYNFDGCRLRVELAH 81 >gb|PNX94652.1| pre-mRNA-splicing factor sf2-like protein [Trifolium pratense] Length = 238 Score = 168 bits (425), Expect = 3e-50 Identities = 78/87 (89%), Positives = 84/87 (96%) Frame = +2 Query: 29 LKLLTDMSGRFSRTIYVGNLPADIRESEIEDLFYKYGRIMDIELKVPPRPPCYCFVEFDN 208 L ++ +MS RFSRTIYVGNLP+DIRESEIEDLFYKYGRIM+IELKVPPRPPCYCFVEFDN Sbjct: 37 LFVVENMSSRFSRTIYVGNLPSDIRESEIEDLFYKYGRIMEIELKVPPRPPCYCFVEFDN 96 Query: 209 ARDAEEAIRGRDGYNFDGCRLRVELAH 289 ARDAE+AIRGRDGYNFDGCRLRVELAH Sbjct: 97 ARDAEDAIRGRDGYNFDGCRLRVELAH 123