BLASTX nr result
ID: Astragalus23_contig00006477
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00006477 (319 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004302153.1| PREDICTED: putative auxin efflux carrier com... 89 1e-18 ref|XP_022845735.1| auxin efflux carrier component 5-like isofor... 89 1e-18 ref|XP_022845733.1| auxin efflux carrier component 5-like isofor... 89 1e-18 emb|CDP04221.1| unnamed protein product [Coffea canephora] 88 2e-18 ref|XP_012834555.1| PREDICTED: putative auxin efflux carrier com... 88 2e-18 gb|AIF28454.1| PIN-like protein, partial [Hakea drupacea] 87 3e-18 ref|XP_019228887.1| PREDICTED: auxin efflux carrier component 5-... 88 3e-18 ref|XP_016480508.1| PREDICTED: putative auxin efflux carrier com... 88 3e-18 ref|XP_009792134.1| PREDICTED: putative auxin efflux carrier com... 88 3e-18 ref|XP_011077194.1| auxin efflux carrier component 5 [Sesamum in... 88 4e-18 gb|PIN18117.1| hypothetical protein CDL12_09217 [Handroanthus im... 87 6e-18 ref|XP_022861065.1| auxin efflux carrier component 5-like, parti... 86 8e-18 ref|XP_016447768.1| PREDICTED: putative auxin efflux carrier com... 86 1e-17 ref|XP_015875637.1| PREDICTED: LOW QUALITY PROTEIN: putative aux... 86 1e-17 ref|XP_009603485.1| PREDICTED: auxin efflux carrier component 5 ... 86 1e-17 gb|ONK56199.1| uncharacterized protein A4U43_C10F5150 [Asparagus... 84 1e-17 dbj|GAY44603.1| hypothetical protein CUMW_083150 [Citrus unshiu] 86 1e-17 ref|XP_017221995.1| PREDICTED: auxin efflux carrier component 5 ... 86 1e-17 ref|XP_021620129.1| auxin efflux carrier component 5-like [Manih... 86 1e-17 ref|XP_014497493.1| auxin efflux carrier component 5 [Vigna radi... 86 1e-17 >ref|XP_004302153.1| PREDICTED: putative auxin efflux carrier component 8 [Fragaria vesca subsp. vesca] Length = 357 Score = 89.0 bits (219), Expect = 1e-18 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = +3 Query: 3 PQSITSFIFAKEYGLHADVLSTAVIFGMIVSLPILIGYYGILEFMH 140 PQSITSFIFAKEYGLHADVLSTAVIFGM+VSLP+LIGYY +LEF+H Sbjct: 312 PQSITSFIFAKEYGLHADVLSTAVIFGMLVSLPVLIGYYAVLEFVH 357 >ref|XP_022845735.1| auxin efflux carrier component 5-like isoform X2 [Olea europaea var. sylvestris] ref|XP_022845737.1| auxin efflux carrier component 5-like isoform X2 [Olea europaea var. sylvestris] Length = 347 Score = 88.6 bits (218), Expect = 1e-18 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = +3 Query: 3 PQSITSFIFAKEYGLHADVLSTAVIFGMIVSLPILIGYYGILEFMH 140 PQSITSFI+AKEYGLHADVLSTAVIFGMIVSLP+LIGYY +LEF+H Sbjct: 302 PQSITSFIYAKEYGLHADVLSTAVIFGMIVSLPVLIGYYAVLEFVH 347 >ref|XP_022845733.1| auxin efflux carrier component 5-like isoform X1 [Olea europaea var. sylvestris] ref|XP_022845736.1| auxin efflux carrier component 5-like isoform X1 [Olea europaea var. sylvestris] Length = 354 Score = 88.6 bits (218), Expect = 1e-18 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = +3 Query: 3 PQSITSFIFAKEYGLHADVLSTAVIFGMIVSLPILIGYYGILEFMH 140 PQSITSFI+AKEYGLHADVLSTAVIFGMIVSLP+LIGYY +LEF+H Sbjct: 309 PQSITSFIYAKEYGLHADVLSTAVIFGMIVSLPVLIGYYAVLEFVH 354 >emb|CDP04221.1| unnamed protein product [Coffea canephora] Length = 357 Score = 88.2 bits (217), Expect = 2e-18 Identities = 40/46 (86%), Positives = 45/46 (97%) Frame = +3 Query: 3 PQSITSFIFAKEYGLHADVLSTAVIFGMIVSLPILIGYYGILEFMH 140 PQSITSFIFAKEYGLHADVLSTAVIFGMIV+LP+++GYY ILEF+H Sbjct: 312 PQSITSFIFAKEYGLHADVLSTAVIFGMIVALPVMVGYYAILEFLH 357 >ref|XP_012834555.1| PREDICTED: putative auxin efflux carrier component 8 [Erythranthe guttata] gb|EYU39429.1| hypothetical protein MIMGU_mgv1a009388mg [Erythranthe guttata] Length = 344 Score = 87.8 bits (216), Expect = 2e-18 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +3 Query: 3 PQSITSFIFAKEYGLHADVLSTAVIFGMIVSLPILIGYYGILEFMH 140 PQSITSFIFAKEYGLHADVLSTAVIFGMIVSLP+LI YY ILEF+H Sbjct: 299 PQSITSFIFAKEYGLHADVLSTAVIFGMIVSLPVLIAYYAILEFVH 344 >gb|AIF28454.1| PIN-like protein, partial [Hakea drupacea] Length = 297 Score = 87.0 bits (214), Expect = 3e-18 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = +3 Query: 3 PQSITSFIFAKEYGLHADVLSTAVIFGMIVSLPILIGYYGILEFMH 140 PQSITSFI+AKEYGLHADVLSTAVI GMI+SLPIL+GYY ILEFMH Sbjct: 252 PQSITSFIYAKEYGLHADVLSTAVILGMILSLPILVGYYAILEFMH 297 >ref|XP_019228887.1| PREDICTED: auxin efflux carrier component 5-like [Nicotiana attenuata] gb|OIT30459.1| auxin efflux carrier component 5 [Nicotiana attenuata] Length = 361 Score = 87.8 bits (216), Expect = 3e-18 Identities = 40/46 (86%), Positives = 45/46 (97%) Frame = +3 Query: 3 PQSITSFIFAKEYGLHADVLSTAVIFGMIVSLPILIGYYGILEFMH 140 PQSITSFIFAKEYGLHA+VLSTAVIFGM+VSLP+L+GYY ILEF+H Sbjct: 316 PQSITSFIFAKEYGLHAEVLSTAVIFGMLVSLPVLVGYYAILEFLH 361 >ref|XP_016480508.1| PREDICTED: putative auxin efflux carrier component 8 [Nicotiana tabacum] Length = 363 Score = 87.8 bits (216), Expect = 3e-18 Identities = 40/46 (86%), Positives = 45/46 (97%) Frame = +3 Query: 3 PQSITSFIFAKEYGLHADVLSTAVIFGMIVSLPILIGYYGILEFMH 140 PQSITSFIFAKEYGLHA+VLSTAVIFGM+VSLP+L+GYY ILEF+H Sbjct: 318 PQSITSFIFAKEYGLHAEVLSTAVIFGMLVSLPVLVGYYAILEFLH 363 >ref|XP_009792134.1| PREDICTED: putative auxin efflux carrier component 8 [Nicotiana sylvestris] Length = 363 Score = 87.8 bits (216), Expect = 3e-18 Identities = 40/46 (86%), Positives = 45/46 (97%) Frame = +3 Query: 3 PQSITSFIFAKEYGLHADVLSTAVIFGMIVSLPILIGYYGILEFMH 140 PQSITSFIFAKEYGLHA+VLSTAVIFGM+VSLP+L+GYY ILEF+H Sbjct: 318 PQSITSFIFAKEYGLHAEVLSTAVIFGMLVSLPVLVGYYAILEFLH 363 >ref|XP_011077194.1| auxin efflux carrier component 5 [Sesamum indicum] Length = 394 Score = 87.8 bits (216), Expect = 4e-18 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = +3 Query: 3 PQSITSFIFAKEYGLHADVLSTAVIFGMIVSLPILIGYYGILEFMH 140 PQSITSFIFAKEYGLHA+VLSTAVIFGMIVSLP+LIGYY +LEF+H Sbjct: 349 PQSITSFIFAKEYGLHAEVLSTAVIFGMIVSLPVLIGYYALLEFVH 394 >gb|PIN18117.1| hypothetical protein CDL12_09217 [Handroanthus impetiginosus] Length = 370 Score = 87.0 bits (214), Expect = 6e-18 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = +3 Query: 3 PQSITSFIFAKEYGLHADVLSTAVIFGMIVSLPILIGYYGILEFMH 140 PQSITSFIFAKEYGLHADVLSTAVIFGMIV LP+LIGYY IL+F+H Sbjct: 325 PQSITSFIFAKEYGLHADVLSTAVIFGMIVCLPVLIGYYAILDFVH 370 >ref|XP_022861065.1| auxin efflux carrier component 5-like, partial [Olea europaea var. sylvestris] Length = 275 Score = 85.5 bits (210), Expect = 8e-18 Identities = 40/45 (88%), Positives = 44/45 (97%) Frame = +3 Query: 3 PQSITSFIFAKEYGLHADVLSTAVIFGMIVSLPILIGYYGILEFM 137 PQSITSFI+AKEYGLHADVLSTAVIFGMIVSLP+LIGYY +LEF+ Sbjct: 230 PQSITSFIYAKEYGLHADVLSTAVIFGMIVSLPVLIGYYAVLEFV 274 >ref|XP_016447768.1| PREDICTED: putative auxin efflux carrier component 8 [Nicotiana tabacum] Length = 361 Score = 86.3 bits (212), Expect = 1e-17 Identities = 39/46 (84%), Positives = 45/46 (97%) Frame = +3 Query: 3 PQSITSFIFAKEYGLHADVLSTAVIFGMIVSLPILIGYYGILEFMH 140 PQSITSFIFAKEYGLHA+VLSTAVIFGM+VSLP+L+GY+ ILEF+H Sbjct: 316 PQSITSFIFAKEYGLHAEVLSTAVIFGMLVSLPVLVGYFAILEFLH 361 >ref|XP_015875637.1| PREDICTED: LOW QUALITY PROTEIN: putative auxin efflux carrier component 8 [Ziziphus jujuba] Length = 361 Score = 86.3 bits (212), Expect = 1e-17 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = +3 Query: 3 PQSITSFIFAKEYGLHADVLSTAVIFGMIVSLPILIGYYGILEFMH 140 PQSITSFIFAKEYGLHA+VLSTAVIFGMIVSLP+LI YY ILEF+H Sbjct: 316 PQSITSFIFAKEYGLHAEVLSTAVIFGMIVSLPVLIAYYAILEFVH 361 >ref|XP_009603485.1| PREDICTED: auxin efflux carrier component 5 [Nicotiana tomentosiformis] Length = 361 Score = 86.3 bits (212), Expect = 1e-17 Identities = 39/46 (84%), Positives = 45/46 (97%) Frame = +3 Query: 3 PQSITSFIFAKEYGLHADVLSTAVIFGMIVSLPILIGYYGILEFMH 140 PQSITSFIFAKEYGLHA+VLSTAVIFGM+VSLP+L+GY+ ILEF+H Sbjct: 316 PQSITSFIFAKEYGLHAEVLSTAVIFGMLVSLPVLVGYFAILEFLH 361 >gb|ONK56199.1| uncharacterized protein A4U43_C10F5150 [Asparagus officinalis] Length = 200 Score = 83.6 bits (205), Expect = 1e-17 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = +3 Query: 3 PQSITSFIFAKEYGLHADVLSTAVIFGMIVSLPILIGYYGILEFMH 140 PQSITSFIFAKEYGLHADVLSTAVIFGM+ SLPIL+ YY +LEFMH Sbjct: 155 PQSITSFIFAKEYGLHADVLSTAVIFGMLASLPILVVYYILLEFMH 200 >dbj|GAY44603.1| hypothetical protein CUMW_083150 [Citrus unshiu] Length = 347 Score = 85.9 bits (211), Expect = 1e-17 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = +3 Query: 3 PQSITSFIFAKEYGLHADVLSTAVIFGMIVSLPILIGYYGILEFMH 140 PQSITSFIFAKEYGLHADVLSTAVIFGMIVSLP++I YY ILEF H Sbjct: 302 PQSITSFIFAKEYGLHADVLSTAVIFGMIVSLPLMIAYYAILEFAH 347 >ref|XP_017221995.1| PREDICTED: auxin efflux carrier component 5 [Daucus carota subsp. sativus] gb|KZM84315.1| hypothetical protein DCAR_028391 [Daucus carota subsp. sativus] Length = 350 Score = 85.9 bits (211), Expect = 1e-17 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = +3 Query: 3 PQSITSFIFAKEYGLHADVLSTAVIFGMIVSLPILIGYYGILEFMH 140 PQSITSFI+AKEYGLHADVLSTAVIFGM+VSLP+LIGYY IL F+H Sbjct: 305 PQSITSFIYAKEYGLHADVLSTAVIFGMLVSLPLLIGYYAILAFLH 350 >ref|XP_021620129.1| auxin efflux carrier component 5-like [Manihot esculenta] gb|OAY43869.1| hypothetical protein MANES_08G104400 [Manihot esculenta] Length = 354 Score = 85.9 bits (211), Expect = 1e-17 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = +3 Query: 3 PQSITSFIFAKEYGLHADVLSTAVIFGMIVSLPILIGYYGILEFMH 140 PQSITSFIFAKEYGLHA+VLSTAVIFGMIVSLP+LI YY +LEF+H Sbjct: 309 PQSITSFIFAKEYGLHAEVLSTAVIFGMIVSLPVLIAYYAVLEFVH 354 >ref|XP_014497493.1| auxin efflux carrier component 5 [Vigna radiata var. radiata] Length = 406 Score = 86.3 bits (212), Expect = 1e-17 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = +3 Query: 3 PQSITSFIFAKEYGLHADVLSTAVIFGMIVSLPILIGYYGILEFMH 140 PQSITSFIFAKEYGLHA+VLSTAVIFGMIVSLPIL+ YY ILEF+H Sbjct: 361 PQSITSFIFAKEYGLHAEVLSTAVIFGMIVSLPILVAYYAILEFIH 406