BLASTX nr result
ID: Astragalus23_contig00006059
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00006059 (1063 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013466515.1| hypothetical protein MTR_1g030850 [Medicago ... 61 1e-07 ref|XP_004498310.1| PREDICTED: leucine-rich repeat extensin-like... 56 8e-06 >ref|XP_013466515.1| hypothetical protein MTR_1g030850 [Medicago truncatula] gb|KEH40556.1| hypothetical protein MTR_1g030850 [Medicago truncatula] Length = 153 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/46 (69%), Positives = 37/46 (80%) Frame = -3 Query: 887 MDLQSKAPRILLNWILILLFCVTIPIQALESRKLVEEKCAPCGDTP 750 MD QSK P +LN IL+L+ CVT+PI A+ESRKLV EKC PCGDTP Sbjct: 1 MDPQSKIPLRILNLILLLV-CVTLPINAMESRKLV-EKCTPCGDTP 44 >ref|XP_004498310.1| PREDICTED: leucine-rich repeat extensin-like protein 6 [Cicer arietinum] Length = 149 Score = 55.8 bits (133), Expect = 8e-06 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = -3 Query: 878 QSKAPRILLNWILILLFCVTIPIQALESRKLVEEKCAPCGDTP 750 QSK +LNWIL+L+F VTIPIQA+ESRKL +E C PCG TP Sbjct: 4 QSKIQLRILNWILLLIF-VTIPIQAIESRKL-DENCTPCGYTP 44