BLASTX nr result
ID: Astragalus23_contig00005222
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00005222 (783 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN09212.1| hypothetical protein glysoja_036440 [Glycine soja] 66 2e-10 gb|KOM43769.1| hypothetical protein LR48_Vigan05g137400 [Vigna a... 57 3e-07 >gb|KHN09212.1| hypothetical protein glysoja_036440 [Glycine soja] Length = 76 Score = 65.9 bits (159), Expect = 2e-10 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = +3 Query: 219 VVADMYMPLLLVRHHNCGACVGINKGSTTCHGVVHFSDTLL 341 +VADM+MPLLLV N GACV I +GST CHGVVHFSD LL Sbjct: 33 IVADMHMPLLLVPDRNSGACVSIGEGSTACHGVVHFSDPLL 73 >gb|KOM43769.1| hypothetical protein LR48_Vigan05g137400 [Vigna angularis] Length = 83 Score = 57.4 bits (137), Expect = 3e-07 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = +3 Query: 219 VVADMYMPLLLVRHHNCGACVGINKGSTTCHGVVHFSDTLL 341 VV DM+MPLLLV + + G +GI KGST CHGVVH SD LL Sbjct: 32 VVVDMHMPLLLVYNGHSGVGIGIGKGSTPCHGVVHLSDPLL 72