BLASTX nr result
ID: Astragalus23_contig00005089
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00005089 (357 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value prf||2022306A salt-inducible protein RF2 53 5e-07 >prf||2022306A salt-inducible protein RF2 Length = 50 Score = 52.8 bits (125), Expect = 5e-07 Identities = 25/42 (59%), Positives = 26/42 (61%) Frame = -1 Query: 357 AAVCLCTTXXXXXXXXXXXXXXXLQVLIDCGKTPPENFKCPA 232 AA+CLCTT LQVLIDCGKTPPE FKCPA Sbjct: 8 AAICLCTTIRLKLLNINLVIPLALQVLIDCGKTPPEGFKCPA 49