BLASTX nr result
ID: Astragalus23_contig00002876
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00002876 (385 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PRQ30374.1| putative protein kinase CAMK-OST1L family [Rosa c... 52 8e-06 >gb|PRQ30374.1| putative protein kinase CAMK-OST1L family [Rosa chinensis] Length = 148 Score = 52.4 bits (124), Expect = 8e-06 Identities = 24/42 (57%), Positives = 32/42 (76%) Frame = -1 Query: 127 ASLLKEVRPRSFALM*YQIDENVRREIINHRSLRHPNIIGFK 2 AS L++++ + Y+IDENV+RE INHRSLRHPNI+ FK Sbjct: 29 ASTLRDLKEAKEEVAKYKIDENVQRETINHRSLRHPNIVRFK 70