BLASTX nr result
ID: Astragalus23_contig00002823
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00002823 (912 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNY01438.1| proteinaceous RNase P 3-like protein, partial [Tr... 61 1e-07 gb|AFK46902.1| unknown [Medicago truncatula] 58 1e-05 >gb|PNY01438.1| proteinaceous RNase P 3-like protein, partial [Trifolium pratense] Length = 150 Score = 60.8 bits (146), Expect = 1e-07 Identities = 30/44 (68%), Positives = 33/44 (75%), Gaps = 1/44 (2%) Frame = -3 Query: 130 LFQEL*KGSWHVPFAPDTSNRSSRSWLCITRTS-DNTIASVSNG 2 + QE KGSWHVP A TSN SSR WLCITR S DN +A+VSNG Sbjct: 62 VIQESEKGSWHVPLALGTSNESSRPWLCITRKSADNNVATVSNG 105 >gb|AFK46902.1| unknown [Medicago truncatula] Length = 392 Score = 57.8 bits (138), Expect = 1e-05 Identities = 26/43 (60%), Positives = 30/43 (69%) Frame = -3 Query: 130 LFQEL*KGSWHVPFAPDTSNRSSRSWLCITRTSDNTIASVSNG 2 + QE KGSWHVP A DTSN SS+ WLCITR S + + SNG Sbjct: 303 VIQESEKGSWHVPLAVDTSNESSKPWLCITRASADDATTASNG 345