BLASTX nr result
ID: Astragalus23_contig00001791
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00001791 (347 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH14932.1| hypothetical protein GLYMA_14G058300 [Glycine max] 55 2e-06 >gb|KRH14932.1| hypothetical protein GLYMA_14G058300 [Glycine max] Length = 1585 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = -1 Query: 314 VWEEALFLPLQ*VEWGCPQCLLMACRPWVAV 222 ++++AL LPLQ V+WGCPQCLLM C PW AV Sbjct: 1528 IYKKALLLPLQWVDWGCPQCLLMVCHPWAAV 1558