BLASTX nr result
ID: Astragalus23_contig00001696
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00001696 (559 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019457269.1| PREDICTED: interactor of constitutive active... 56 7e-06 >ref|XP_019457269.1| PREDICTED: interactor of constitutive active ROPs 3-like [Lupinus angustifolius] gb|OIW03941.1| hypothetical protein TanjilG_30217 [Lupinus angustifolius] Length = 584 Score = 56.2 bits (134), Expect = 7e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 256 RNYECVAELKGDLMDKEKTLLNILEENEMLK 164 R YECVAELKGDLMDKEKTL NI E+NEMLK Sbjct: 418 RLYECVAELKGDLMDKEKTLQNISEDNEMLK 448