BLASTX nr result
ID: Astragalus23_contig00000396
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00000396 (315 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004499312.1| PREDICTED: thioredoxin-like protein CDSP32, ... 54 6e-06 >ref|XP_004499312.1| PREDICTED: thioredoxin-like protein CDSP32, chloroplastic [Cicer arietinum] Length = 324 Score = 53.5 bits (127), Expect = 6e-06 Identities = 38/86 (44%), Positives = 44/86 (51%), Gaps = 5/86 (5%) Frame = +1 Query: 73 NLLCKPLIPLSTTQLPPNFLPL--IVSSLPNFQTKIHSPGSPIGLKVRVGGASSRRFIXX 246 N +CKP IP + + P FLPL + SSLPNF TK HS + + RRFI Sbjct: 28 NFICKPPIPAPS--IHPKFLPLHSLSSSLPNFHTKNHSSHMRVS-----SHENQRRFITK 80 Query: 247 XXXXXXXXXX---DERVQRVHSIEEF 315 DERVQRVHSIEEF Sbjct: 81 ATAASDAKRKEKSDERVQRVHSIEEF 106