BLASTX nr result
ID: Astragalus23_contig00000395
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00000395 (324 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004499312.1| PREDICTED: thioredoxin-like protein CDSP32, ... 53 8e-06 >ref|XP_004499312.1| PREDICTED: thioredoxin-like protein CDSP32, chloroplastic [Cicer arietinum] Length = 324 Score = 53.1 bits (126), Expect = 8e-06 Identities = 38/84 (45%), Positives = 44/84 (52%), Gaps = 5/84 (5%) Frame = +1 Query: 88 NLLCKPLIPLSTTQPPNFPPL--IVSSLPNFQTKIHSPGSPIGLKVRVGASSRRFIXXXX 261 N +CKP IP + P F PL + SSLPNF TK HS ++V + RRFI Sbjct: 28 NFICKPPIPAPSIHP-KFLPLHSLSSSLPNFHTKNHSSH----MRVSSHENQRRFITKAT 82 Query: 262 XXXXXXXX---DERVQRVHSIEEF 324 DERVQRVHSIEEF Sbjct: 83 AASDAKRKEKSDERVQRVHSIEEF 106