BLASTX nr result
ID: Astragalus23_contig00000123
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus23_contig00000123 (1876 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003629195.2| hypothetical protein MTR_8g074390 [Medicago ... 57 1e-06 ref|XP_013465922.1| hypothetical protein MTR_1g016950 [Medicago ... 55 4e-06 ref|XP_003592568.1| hypothetical protein MTR_1g108620 [Medicago ... 55 5e-06 >ref|XP_003629195.2| hypothetical protein MTR_8g074390 [Medicago truncatula] gb|AET03671.2| hypothetical protein MTR_8g074390 [Medicago truncatula] Length = 73 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +3 Query: 1518 YISRGAFESNPQGYFSGLHSADKANK 1595 YISRGAFE+NPQGYFSGLHSADKANK Sbjct: 48 YISRGAFENNPQGYFSGLHSADKANK 73 >ref|XP_013465922.1| hypothetical protein MTR_1g016950 [Medicago truncatula] gb|KEH39958.1| hypothetical protein MTR_1g016950 [Medicago truncatula] Length = 67 Score = 55.1 bits (131), Expect = 4e-06 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = +1 Query: 1645 KGREMKAPGGGGSYISRQVFEKNPKSYFADLRAGQ 1749 KG MKAPGG GS ISR+ FEKNPK YFADL A Q Sbjct: 27 KGDTMKAPGGDGSNISREQFEKNPKGYFADLHAAQ 61 >ref|XP_003592568.1| hypothetical protein MTR_1g108620 [Medicago truncatula] gb|AES62819.1| hypothetical protein MTR_1g108620 [Medicago truncatula] Length = 76 Score = 55.1 bits (131), Expect = 5e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +3 Query: 1518 YISRGAFESNPQGYFSGLHSADKANK 1595 YISRGAFESNPQGYF GLH+ADKANK Sbjct: 51 YISRGAFESNPQGYFGGLHAADKANK 76