BLASTX nr result
ID: Astragalus22_contig00038794
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00038794 (584 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003630432.2| VQ motif protein [Medicago truncatula] >gi|6... 94 2e-20 ref|XP_003525159.1| PREDICTED: VQ motif-containing protein 31-li... 93 3e-20 gb|AFK36416.1| unknown [Medicago truncatula] 92 1e-19 gb|KYP48976.1| hypothetical protein KK1_029276 [Cajanus cajan] 86 3e-18 gb|PNY13863.1| hypothetical protein L195_g010531 [Trifolium prat... 87 7e-18 ref|XP_020233521.1| VQ motif-containing protein 31 [Cajanus cajan] 86 2e-17 gb|OIW17802.1| hypothetical protein TanjilG_02430 [Lupinus angus... 85 5e-17 ref|XP_019463079.1| PREDICTED: VQ motif-containing protein 31-li... 85 5e-17 gb|OIW18236.1| hypothetical protein TanjilG_06320 [Lupinus angus... 84 7e-17 ref|XP_019436433.1| PREDICTED: VQ motif-containing protein 31-li... 84 8e-17 gb|KOM30509.1| hypothetical protein LR48_Vigan01g006300 [Vigna a... 84 1e-16 ref|XP_017439974.1| PREDICTED: VQ motif-containing protein 31-li... 84 1e-16 ref|XP_017439965.1| PREDICTED: VQ motif-containing protein 31-li... 84 1e-16 ref|XP_004503858.1| PREDICTED: VQ motif-containing protein 31 [C... 84 1e-16 ref|XP_017439956.1| PREDICTED: VQ motif-containing protein 31-li... 84 1e-16 dbj|GAU25444.1| hypothetical protein TSUD_70980 [Trifolium subte... 83 3e-16 ref|XP_014508320.1| VQ motif-containing protein 31 isoform X4 [V... 81 1e-15 gb|KRH41023.1| hypothetical protein GLYMA_08G005700 [Glycine max] 81 1e-15 ref|XP_006584677.1| PREDICTED: VQ motif-containing protein 31-li... 81 1e-15 ref|XP_014508318.1| VQ motif-containing protein 31 isoform X3 [V... 81 1e-15 >ref|XP_003630432.2| VQ motif protein [Medicago truncatula] gb|AET04908.2| VQ motif protein [Medicago truncatula] Length = 192 Score = 94.0 bits (232), Expect = 2e-20 Identities = 47/60 (78%), Positives = 50/60 (83%), Gaps = 3/60 (5%) Frame = +3 Query: 129 EDEKKN---VPEINVEEEEKAIKERRFYLHPSPRSKPDGYNEPALLNLFPLASPTASEKV 299 EDEKK + EIN+EEEEKAIKERRFYLHPSPRSK G+NEP LLNLFPLASP A EKV Sbjct: 133 EDEKKQGSVINEINIEEEEKAIKERRFYLHPSPRSKASGFNEPELLNLFPLASPKACEKV 192 >ref|XP_003525159.1| PREDICTED: VQ motif-containing protein 31-like [Glycine max] ref|XP_006580372.1| PREDICTED: VQ motif-containing protein 31-like [Glycine max] ref|XP_006580373.1| PREDICTED: VQ motif-containing protein 31-like [Glycine max] ref|XP_006580375.1| PREDICTED: VQ motif-containing protein 31-like [Glycine max] ref|XP_006580376.1| PREDICTED: VQ motif-containing protein 31-like [Glycine max] gb|KHN17438.1| hypothetical protein glysoja_026981 [Glycine soja] gb|KRH59699.1| hypothetical protein GLYMA_05G198400 [Glycine max] gb|KRH59700.1| hypothetical protein GLYMA_05G198400 [Glycine max] gb|KRH59701.1| hypothetical protein GLYMA_05G198400 [Glycine max] gb|KRH59702.1| hypothetical protein GLYMA_05G198400 [Glycine max] gb|KRH59703.1| hypothetical protein GLYMA_05G198400 [Glycine max] Length = 186 Score = 93.2 bits (230), Expect = 3e-20 Identities = 48/60 (80%), Positives = 51/60 (85%), Gaps = 3/60 (5%) Frame = +3 Query: 129 EDEKKN---VPEINVEEEEKAIKERRFYLHPSPRSKPDGYNEPALLNLFPLASPTASEKV 299 EDEKK +PE+N EEEEKAIKERRFYLHPSPR+KP GY EP LLNLFPLASP ASEKV Sbjct: 128 EDEKKQESVMPEVNKEEEEKAIKERRFYLHPSPRAKP-GYTEPELLNLFPLASPNASEKV 186 >gb|AFK36416.1| unknown [Medicago truncatula] Length = 192 Score = 91.7 bits (226), Expect = 1e-19 Identities = 46/60 (76%), Positives = 49/60 (81%), Gaps = 3/60 (5%) Frame = +3 Query: 129 EDEKKN---VPEINVEEEEKAIKERRFYLHPSPRSKPDGYNEPALLNLFPLASPTASEKV 299 EDEKK + EIN+EEEEKAIKERRFYLHPSPR K G+NEP LLNLFPLASP A EKV Sbjct: 133 EDEKKQGSVINEINIEEEEKAIKERRFYLHPSPRFKASGFNEPELLNLFPLASPKACEKV 192 >gb|KYP48976.1| hypothetical protein KK1_029276 [Cajanus cajan] Length = 117 Score = 85.9 bits (211), Expect = 3e-18 Identities = 46/59 (77%), Positives = 48/59 (81%), Gaps = 3/59 (5%) Frame = +3 Query: 132 DEKKN---VPEINVEEEEKAIKERRFYLHPSPRSKPDGYNEPALLNLFPLASPTASEKV 299 DEKK + E+N EEEEKAIKERRFYLHPSPRSKP GY EP LL LFPLASP ASEKV Sbjct: 60 DEKKEESVMAELNTEEEEKAIKERRFYLHPSPRSKP-GYTEPELLILFPLASPKASEKV 117 >gb|PNY13863.1| hypothetical protein L195_g010531 [Trifolium pratense] Length = 191 Score = 87.0 bits (214), Expect = 7e-18 Identities = 44/58 (75%), Positives = 49/58 (84%), Gaps = 1/58 (1%) Frame = +3 Query: 129 EDEKKN-VPEINVEEEEKAIKERRFYLHPSPRSKPDGYNEPALLNLFPLASPTASEKV 299 EDE+K + EIN+EEEEKAIKERRFYLHPSPRSK G+ EP LL LFPLASP ASE+V Sbjct: 134 EDERKQELNEINIEEEEKAIKERRFYLHPSPRSKSGGFGEPELLVLFPLASPKASEEV 191 >ref|XP_020233521.1| VQ motif-containing protein 31 [Cajanus cajan] Length = 195 Score = 85.9 bits (211), Expect = 2e-17 Identities = 46/59 (77%), Positives = 48/59 (81%), Gaps = 3/59 (5%) Frame = +3 Query: 132 DEKKN---VPEINVEEEEKAIKERRFYLHPSPRSKPDGYNEPALLNLFPLASPTASEKV 299 DEKK + E+N EEEEKAIKERRFYLHPSPRSKP GY EP LL LFPLASP ASEKV Sbjct: 138 DEKKEESVMAELNTEEEEKAIKERRFYLHPSPRSKP-GYTEPELLILFPLASPKASEKV 195 >gb|OIW17802.1| hypothetical protein TanjilG_02430 [Lupinus angustifolius] Length = 185 Score = 84.7 bits (208), Expect = 5e-17 Identities = 44/60 (73%), Positives = 48/60 (80%), Gaps = 3/60 (5%) Frame = +3 Query: 129 EDEKKN---VPEINVEEEEKAIKERRFYLHPSPRSKPDGYNEPALLNLFPLASPTASEKV 299 EDEKK VPE+N EEEEKAI+ERRFYLHPSPRSK G++EP LL LFPLASP AS V Sbjct: 127 EDEKKEDSVVPELNTEEEEKAIRERRFYLHPSPRSK-QGFSEPELLTLFPLASPNASNNV 185 >ref|XP_019463079.1| PREDICTED: VQ motif-containing protein 31-like [Lupinus angustifolius] Length = 187 Score = 84.7 bits (208), Expect = 5e-17 Identities = 44/60 (73%), Positives = 48/60 (80%), Gaps = 3/60 (5%) Frame = +3 Query: 129 EDEKKN---VPEINVEEEEKAIKERRFYLHPSPRSKPDGYNEPALLNLFPLASPTASEKV 299 EDEKK VPE+N EEEEKAI+ERRFYLHPSPRSK G++EP LL LFPLASP AS V Sbjct: 129 EDEKKEDSVVPELNTEEEEKAIRERRFYLHPSPRSK-QGFSEPELLTLFPLASPNASNNV 187 >gb|OIW18236.1| hypothetical protein TanjilG_06320 [Lupinus angustifolius] Length = 188 Score = 84.3 bits (207), Expect = 7e-17 Identities = 43/61 (70%), Positives = 49/61 (80%), Gaps = 3/61 (4%) Frame = +3 Query: 126 FEDEK---KNVPEINVEEEEKAIKERRFYLHPSPRSKPDGYNEPALLNLFPLASPTASEK 296 FEDEK +PE+N EEEEKAI+ERRFYLHPSPRSK G++EP LL LFPLASP S+K Sbjct: 129 FEDEKIEDSAMPELNTEEEEKAIRERRFYLHPSPRSK-QGFSEPQLLTLFPLASPNTSDK 187 Query: 297 V 299 V Sbjct: 188 V 188 >ref|XP_019436433.1| PREDICTED: VQ motif-containing protein 31-like [Lupinus angustifolius] Length = 194 Score = 84.3 bits (207), Expect = 8e-17 Identities = 43/61 (70%), Positives = 49/61 (80%), Gaps = 3/61 (4%) Frame = +3 Query: 126 FEDEK---KNVPEINVEEEEKAIKERRFYLHPSPRSKPDGYNEPALLNLFPLASPTASEK 296 FEDEK +PE+N EEEEKAI+ERRFYLHPSPRSK G++EP LL LFPLASP S+K Sbjct: 135 FEDEKIEDSAMPELNTEEEEKAIRERRFYLHPSPRSK-QGFSEPQLLTLFPLASPNTSDK 193 Query: 297 V 299 V Sbjct: 194 V 194 >gb|KOM30509.1| hypothetical protein LR48_Vigan01g006300 [Vigna angularis] Length = 186 Score = 84.0 bits (206), Expect = 1e-16 Identities = 41/57 (71%), Positives = 48/57 (84%) Frame = +3 Query: 135 EKKNVPEINVEEEEKAIKERRFYLHPSPRSKPDGYNEPALLNLFPLASPTASEKV*F 305 E+ +PE+N EEEEKAIKERRFYLHPSPR+KP GY++P LL LFPLAS ASEK+ F Sbjct: 131 EESTMPELNTEEEEKAIKERRFYLHPSPRAKP-GYSDPELLILFPLASAKASEKIEF 186 >ref|XP_017439974.1| PREDICTED: VQ motif-containing protein 31-like isoform X3 [Vigna angularis] Length = 188 Score = 84.0 bits (206), Expect = 1e-16 Identities = 41/57 (71%), Positives = 48/57 (84%) Frame = +3 Query: 135 EKKNVPEINVEEEEKAIKERRFYLHPSPRSKPDGYNEPALLNLFPLASPTASEKV*F 305 E+ +PE+N EEEEKAIKERRFYLHPSPR+KP GY++P LL LFPLAS ASEK+ F Sbjct: 133 EESTMPELNTEEEEKAIKERRFYLHPSPRAKP-GYSDPELLILFPLASAKASEKIEF 188 >ref|XP_017439965.1| PREDICTED: VQ motif-containing protein 31-like isoform X2 [Vigna angularis] Length = 201 Score = 84.0 bits (206), Expect = 1e-16 Identities = 41/57 (71%), Positives = 48/57 (84%) Frame = +3 Query: 135 EKKNVPEINVEEEEKAIKERRFYLHPSPRSKPDGYNEPALLNLFPLASPTASEKV*F 305 E+ +PE+N EEEEKAIKERRFYLHPSPR+KP GY++P LL LFPLAS ASEK+ F Sbjct: 146 EESTMPELNTEEEEKAIKERRFYLHPSPRAKP-GYSDPELLILFPLASAKASEKIEF 201 >ref|XP_004503858.1| PREDICTED: VQ motif-containing protein 31 [Cicer arietinum] ref|XP_004503859.1| PREDICTED: VQ motif-containing protein 31 [Cicer arietinum] Length = 201 Score = 84.0 bits (206), Expect = 1e-16 Identities = 43/58 (74%), Positives = 47/58 (81%), Gaps = 1/58 (1%) Frame = +3 Query: 129 EDEKKNVPEINVEEEEKAIKERRFYLHPSPRSKPDGY-NEPALLNLFPLASPTASEKV 299 E +KK I +EEEKAIKERRFYLHPSPRSKP+GY NEP LL LFPLASP A+EKV Sbjct: 144 EGQKKQEINIQQDEEEKAIKERRFYLHPSPRSKPNGYNNEPELLILFPLASPNATEKV 201 >ref|XP_017439956.1| PREDICTED: VQ motif-containing protein 31-like isoform X1 [Vigna angularis] dbj|BAT73186.1| hypothetical protein VIGAN_01065000 [Vigna angularis var. angularis] Length = 206 Score = 84.0 bits (206), Expect = 1e-16 Identities = 41/57 (71%), Positives = 48/57 (84%) Frame = +3 Query: 135 EKKNVPEINVEEEEKAIKERRFYLHPSPRSKPDGYNEPALLNLFPLASPTASEKV*F 305 E+ +PE+N EEEEKAIKERRFYLHPSPR+KP GY++P LL LFPLAS ASEK+ F Sbjct: 151 EESTMPELNTEEEEKAIKERRFYLHPSPRAKP-GYSDPELLILFPLASAKASEKIEF 206 >dbj|GAU25444.1| hypothetical protein TSUD_70980 [Trifolium subterraneum] Length = 191 Score = 82.8 bits (203), Expect = 3e-16 Identities = 39/56 (69%), Positives = 46/56 (82%) Frame = +3 Query: 132 DEKKNVPEINVEEEEKAIKERRFYLHPSPRSKPDGYNEPALLNLFPLASPTASEKV 299 + K+ + EIN+EEEEKAIKERRFYLHPSPRSK + EP LL LFPLASP AS++V Sbjct: 136 ERKQELTEINIEEEEKAIKERRFYLHPSPRSKSGSFGEPELLVLFPLASPKASDQV 191 >ref|XP_014508320.1| VQ motif-containing protein 31 isoform X4 [Vigna radiata var. radiata] ref|XP_014508321.1| VQ motif-containing protein 31 isoform X4 [Vigna radiata var. radiata] Length = 188 Score = 81.3 bits (199), Expect = 1e-15 Identities = 44/62 (70%), Positives = 49/62 (79%), Gaps = 3/62 (4%) Frame = +3 Query: 129 EDEKKN---VPEINVEEEEKAIKERRFYLHPSPRSKPDGYNEPALLNLFPLASPTASEKV 299 E EKK + E+N EEEEKAIKERRFYLHPSPRSKP GY++P LL LFPLAS ASEK+ Sbjct: 128 ESEKKEESMMAELNTEEEEKAIKERRFYLHPSPRSKP-GYSDPELLILFPLASAKASEKL 186 Query: 300 *F 305 F Sbjct: 187 EF 188 >gb|KRH41023.1| hypothetical protein GLYMA_08G005700 [Glycine max] Length = 174 Score = 80.9 bits (198), Expect = 1e-15 Identities = 45/59 (76%), Positives = 47/59 (79%), Gaps = 2/59 (3%) Frame = +3 Query: 129 EDEKKNVPEINV--EEEEKAIKERRFYLHPSPRSKPDGYNEPALLNLFPLASPTASEKV 299 EDEKK +N EEEEKAIKERRFYLHPSPR+KP GY EP LLNLFPLAS ASEKV Sbjct: 118 EDEKKE-ESVNTAEEEEEKAIKERRFYLHPSPRAKP-GYTEPELLNLFPLASRNASEKV 174 >ref|XP_006584677.1| PREDICTED: VQ motif-containing protein 31-like [Glycine max] ref|XP_006584678.1| PREDICTED: VQ motif-containing protein 31-like [Glycine max] ref|XP_006584679.1| PREDICTED: VQ motif-containing protein 31-like [Glycine max] gb|KHN16905.1| hypothetical protein glysoja_003002 [Glycine soja] Length = 176 Score = 80.9 bits (198), Expect = 1e-15 Identities = 45/59 (76%), Positives = 47/59 (79%), Gaps = 2/59 (3%) Frame = +3 Query: 129 EDEKKNVPEINV--EEEEKAIKERRFYLHPSPRSKPDGYNEPALLNLFPLASPTASEKV 299 EDEKK +N EEEEKAIKERRFYLHPSPR+KP GY EP LLNLFPLAS ASEKV Sbjct: 120 EDEKKE-ESVNTAEEEEEKAIKERRFYLHPSPRAKP-GYTEPELLNLFPLASRNASEKV 176 >ref|XP_014508318.1| VQ motif-containing protein 31 isoform X3 [Vigna radiata var. radiata] ref|XP_022638785.1| VQ motif-containing protein 31 isoform X3 [Vigna radiata var. radiata] Length = 201 Score = 81.3 bits (199), Expect = 1e-15 Identities = 44/62 (70%), Positives = 49/62 (79%), Gaps = 3/62 (4%) Frame = +3 Query: 129 EDEKKN---VPEINVEEEEKAIKERRFYLHPSPRSKPDGYNEPALLNLFPLASPTASEKV 299 E EKK + E+N EEEEKAIKERRFYLHPSPRSKP GY++P LL LFPLAS ASEK+ Sbjct: 141 ESEKKEESMMAELNTEEEEKAIKERRFYLHPSPRSKP-GYSDPELLILFPLASAKASEKL 199 Query: 300 *F 305 F Sbjct: 200 EF 201