BLASTX nr result
ID: Astragalus22_contig00038663
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00038663 (388 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU27876.1| hypothetical protein TSUD_159700 [Trifolium subt... 59 3e-07 gb|KOM46148.1| hypothetical protein LR48_Vigan06g145400 [Vigna a... 56 6e-07 gb|KOM56592.1| hypothetical protein LR48_Vigan10g248400 [Vigna a... 53 3e-06 gb|KOM58362.1| hypothetical protein LR48_Vigan11g139600 [Vigna a... 55 5e-06 ref|XP_020266951.1| uncharacterized protein LOC109842493 [Aspara... 54 7e-06 gb|OIS99581.1| uncharacterized protein A4A49_22393 [Nicotiana at... 54 8e-06 dbj|BAT82265.1| hypothetical protein VIGAN_03224900 [Vigna angul... 53 1e-05 >dbj|GAU27876.1| hypothetical protein TSUD_159700 [Trifolium subterraneum] Length = 1257 Score = 58.5 bits (140), Expect = 3e-07 Identities = 32/57 (56%), Positives = 39/57 (68%) Frame = -1 Query: 355 YNLNLGLDKCSA*SLENVKCVLLTYTWSQNCY*CYSPSIHRYLVLNNVTSFEFVPFF 185 +NL+ GLDK SA SL KCV L Y SQ Y CYSP++ RYLV +VT FE +P+F Sbjct: 505 HNLSPGLDKLSARSL---KCVFLGYHRSQKGYRCYSPTLKRYLVSADVTFFESIPYF 558 >gb|KOM46148.1| hypothetical protein LR48_Vigan06g145400 [Vigna angularis] Length = 194 Score = 56.2 bits (134), Expect = 6e-07 Identities = 28/57 (49%), Positives = 36/57 (63%) Frame = -1 Query: 355 YNLNLGLDKCSA*SLENVKCVLLTYTWSQNCY*CYSPSIHRYLVLNNVTSFEFVPFF 185 +N++ GLDK S L+ +KCV Y+ Q CY CYSPS RY + +VT FE PFF Sbjct: 60 HNVSPGLDKLS---LKAIKCVFFGYSCLQKCYKCYSPSTKRYYMSADVTFFEHTPFF 113 >gb|KOM56592.1| hypothetical protein LR48_Vigan10g248400 [Vigna angularis] Length = 120 Score = 52.8 bits (125), Expect = 3e-06 Identities = 27/57 (47%), Positives = 37/57 (64%) Frame = -1 Query: 355 YNLNLGLDKCSA*SLENVKCVLLTYTWSQNCY*CYSPSIHRYLVLNNVTSFEFVPFF 185 +N++ GLDK S +++KCV L Y+ Q Y CYSPS RY + ++VT FE PFF Sbjct: 36 HNVSPGLDKLSP---KSIKCVFLGYSRIQKGYRCYSPSTRRYYMSSDVTFFEDTPFF 89 >gb|KOM58362.1| hypothetical protein LR48_Vigan11g139600 [Vigna angularis] Length = 492 Score = 54.7 bits (130), Expect = 5e-06 Identities = 29/57 (50%), Positives = 37/57 (64%) Frame = -1 Query: 355 YNLNLGLDKCSA*SLENVKCVLLTYTWSQNCY*CYSPSIHRYLVLNNVTSFEFVPFF 185 +N++LGLDK SA + +KCV L Y+ Q Y CYSPS RY + +VT FE PFF Sbjct: 141 HNVSLGLDKVSA---KAIKCVFLGYSRLQKGYKCYSPSTKRYYMSADVTFFEDTPFF 194 >ref|XP_020266951.1| uncharacterized protein LOC109842493 [Asparagus officinalis] Length = 895 Score = 54.3 bits (129), Expect = 7e-06 Identities = 29/73 (39%), Positives = 42/73 (57%) Frame = -1 Query: 388 VSLYLRTLSIFYNLNLGLDKCSA*SLENVKCVLLTYTWSQNCY*CYSPSIHRYLVLNNVT 209 V YL + + +L GLDK S+ ++KCV + Y +Q Y CY PS +Y V +VT Sbjct: 462 VPKYLWSDVVLTDLTTGLDKLSS---RSIKCVFIGYPRTQKGYRCYHPSTRKYFVSADVT 518 Query: 208 SFEFVPFFGALSS 170 FE+VP+F S+ Sbjct: 519 FFEYVPYFSYTST 531 >gb|OIS99581.1| uncharacterized protein A4A49_22393 [Nicotiana attenuata] Length = 1863 Score = 54.3 bits (129), Expect = 8e-06 Identities = 33/77 (42%), Positives = 45/77 (58%) Frame = -1 Query: 355 YNLNLGLDKCSA*SLENVKCVLLTYTWSQNCY*CYSPSIHRYLVLNNVTSFEFVPFFGAL 176 +NL LG DK + L +KCV L Y+ Q Y CYSP + RYL+L VT FE PFF + Sbjct: 1047 HNLALGKDKLA---LRALKCVFLGYSRVQKRYRCYSPILRRYLMLAGVTFFESKPFFTS- 1102 Query: 175 SSIMMVHCILHITNYRK 125 S + ++ +L I + K Sbjct: 1103 SDHLDIYEVLPIPTFEK 1119 >dbj|BAT82265.1| hypothetical protein VIGAN_03224900 [Vigna angularis var. angularis] Length = 184 Score = 52.8 bits (125), Expect = 1e-05 Identities = 27/57 (47%), Positives = 37/57 (64%) Frame = -1 Query: 355 YNLNLGLDKCSA*SLENVKCVLLTYTWSQNCY*CYSPSIHRYLVLNNVTSFEFVPFF 185 +N++ GLDK S +++KCV L Y+ Q Y CYSPS RY + ++VT FE PFF Sbjct: 36 HNVSPGLDKLSP---KSIKCVFLGYSRIQKGYRCYSPSTRRYYMSSDVTFFEDTPFF 89