BLASTX nr result
ID: Astragalus22_contig00038573
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00038573 (311 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU20106.1| hypothetical protein TSUD_381980 [Trifolium subt... 42 4e-06 dbj|GAU20105.1| hypothetical protein TSUD_381970 [Trifolium subt... 41 9e-06 >dbj|GAU20106.1| hypothetical protein TSUD_381980 [Trifolium subterraneum] Length = 219 Score = 42.4 bits (98), Expect(2) = 4e-06 Identities = 19/39 (48%), Positives = 28/39 (71%) Frame = +2 Query: 194 EDMDLNDFRNLYDDRKEPFHYHSDRLVYKNKAQIRLDEE 310 +D+ L+DF ++YDD +PF + DR VYKNKA I ++E Sbjct: 58 KDLTLSDF-SMYDDDAKPFFFDCDRFVYKNKAMINKEKE 95 Score = 35.8 bits (81), Expect(2) = 4e-06 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +1 Query: 115 PPPEIAEAPGKRPKSEPETPLKSETRRR 198 PPPE E GKRPKSEPE K + R+ Sbjct: 18 PPPENLEERGKRPKSEPEPEQKQKPERK 45 >dbj|GAU20105.1| hypothetical protein TSUD_381970 [Trifolium subterraneum] Length = 234 Score = 41.2 bits (95), Expect(2) = 9e-06 Identities = 18/39 (46%), Positives = 28/39 (71%) Frame = +2 Query: 194 EDMDLNDFRNLYDDRKEPFHYHSDRLVYKNKAQIRLDEE 310 +D+ L+DF ++YDD +PF + D+ VYKNKA I ++E Sbjct: 58 KDLTLSDF-SMYDDDAKPFFFDCDKFVYKNKAMINKEKE 95 Score = 35.8 bits (81), Expect(2) = 9e-06 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +1 Query: 115 PPPEIAEAPGKRPKSEPETPLKSETRRR 198 PPPE E GKRPKSEPE K + R+ Sbjct: 18 PPPENLEERGKRPKSEPEPEQKQKPERK 45