BLASTX nr result
ID: Astragalus22_contig00038386
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00038386 (392 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007161674.1| hypothetical protein PHAVU_001G0890002g, par... 57 6e-07 >ref|XP_007161674.1| hypothetical protein PHAVU_001G0890002g, partial [Phaseolus vulgaris] gb|ESW33668.1| hypothetical protein PHAVU_001G0890002g, partial [Phaseolus vulgaris] Length = 585 Score = 57.4 bits (137), Expect = 6e-07 Identities = 29/68 (42%), Positives = 40/68 (58%), Gaps = 1/68 (1%) Frame = +1 Query: 187 NMLCLFVAIKLDIPNNDKLRKHWISFAGVCWTQFKAAPTKDYVFGS-GEKHGNTTPYEKY 363 N + + I D+P N+ LRK WIS+AG WT FK+ T Y++G+ GEK P E+Y Sbjct: 78 NQIWQSIIITYDVPKNNLLRKKWISYAGARWTGFKSDLTSRYIYGALGEK----IPCEQY 133 Query: 364 SCISIETW 387 + ETW Sbjct: 134 QFLDEETW 141