BLASTX nr result
ID: Astragalus22_contig00038333
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00038333 (480 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004497885.1| PREDICTED: centromere-associated protein E i... 55 7e-06 ref|XP_012570474.1| PREDICTED: centromere-associated protein E i... 55 7e-06 >ref|XP_004497885.1| PREDICTED: centromere-associated protein E isoform X2 [Cicer arietinum] Length = 1313 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -2 Query: 275 DRKAYQKIRYEEGSWRMKDVLASQGLEVLNLKKQLSTTEGQ 153 D KI+Y+E S R+KD+LASQGLEVLNLKKQL+ +GQ Sbjct: 1273 DESVLSKIKYKEASGRLKDMLASQGLEVLNLKKQLAAAKGQ 1313 >ref|XP_012570474.1| PREDICTED: centromere-associated protein E isoform X1 [Cicer arietinum] Length = 1314 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -2 Query: 275 DRKAYQKIRYEEGSWRMKDVLASQGLEVLNLKKQLSTTEGQ 153 D KI+Y+E S R+KD+LASQGLEVLNLKKQL+ +GQ Sbjct: 1274 DESVLSKIKYKEASGRLKDMLASQGLEVLNLKKQLAAAKGQ 1314