BLASTX nr result
ID: Astragalus22_contig00037891
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00037891 (376 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN41721.1| Pentatricopeptide repeat-containing protein, mito... 77 7e-14 ref|XP_020216447.1| pentatricopeptide repeat-containing protein ... 76 1e-13 ref|XP_014628080.1| PREDICTED: pentatricopeptide repeat-containi... 73 2e-12 gb|KRG90497.1| hypothetical protein GLYMA_20G094700 [Glycine max] 73 2e-12 ref|XP_004511762.1| PREDICTED: pentatricopeptide repeat-containi... 72 4e-12 ref|XP_003611431.1| pentatricopeptide (PPR) repeat protein [Medi... 71 7e-12 gb|KHN42634.1| Pentatricopeptide repeat-containing protein, mito... 67 2e-10 gb|KRH77249.1| hypothetical protein GLYMA_01G201800 [Glycine max] 67 2e-10 gb|PNY05497.1| pentatricopeptide repeat-containing protein at4g0... 67 2e-10 ref|XP_007156631.1| hypothetical protein PHAVU_002G004400g [Phas... 67 3e-10 ref|XP_017427849.1| PREDICTED: pentatricopeptide repeat-containi... 66 6e-10 dbj|BAU00371.1| hypothetical protein VIGAN_10195800 [Vigna angul... 65 1e-09 ref|XP_014521217.1| pentatricopeptide repeat-containing protein ... 65 1e-09 ref|XP_014520925.1| pentatricopeptide repeat-containing protein ... 65 1e-09 ref|XP_017423737.1| PREDICTED: pentatricopeptide repeat-containi... 62 3e-09 gb|KOM54794.1| hypothetical protein LR48_Vigan10g068600 [Vigna a... 62 6e-09 ref|XP_017439682.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-08 ref|XP_017427263.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-08 gb|KRH76357.1| hypothetical protein GLYMA_01G147900 [Glycine max] 60 4e-08 ref|XP_016175852.1| pentatricopeptide repeat-containing protein ... 60 4e-08 >gb|KHN41721.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 737 Score = 77.0 bits (188), Expect = 7e-14 Identities = 35/76 (46%), Positives = 49/76 (64%) Frame = +3 Query: 144 VSKLQYECSYSTNYHYQPLKASLALSRKTKCDESQLLHYLRNGWHHEALKILHSFSDRDV 323 + K + Y N H +P K ++T+CDES LLHYL NGWH +A +L + S D+ Sbjct: 23 ILKSSFHNVYRVN-HSRPRKPPFPFPKRTECDESLLLHYLSNGWHDDARNLLQNSSGGDL 81 Query: 324 HAHIVRWTSLLANFTR 371 H+ +VRWTSLL+NF+R Sbjct: 82 HSRVVRWTSLLSNFSR 97 >ref|XP_020216447.1| pentatricopeptide repeat-containing protein At1g32415, mitochondrial [Cajanus cajan] Length = 732 Score = 76.3 bits (186), Expect = 1e-13 Identities = 40/98 (40%), Positives = 57/98 (58%) Frame = +3 Query: 78 HPPILLRLMRGSTSTSSLRRFFVSKLQYECSYSTNYHYQPLKASLALSRKTKCDESQLLH 257 H PI R++ S + +Q++ + +N H QP K K +CDES LLH Sbjct: 6 HSPIFPRILNSSFGS----------VQHQHVHRSN-HPQPQKPQFPFPPKPECDESLLLH 54 Query: 258 YLRNGWHHEALKILHSFSDRDVHAHIVRWTSLLANFTR 371 YL NG HHEA +L + S+ D+H +VRWTSLL++F+R Sbjct: 55 YLSNGLHHEAQNLLQNSSEGDLHTRVVRWTSLLSSFSR 92 >ref|XP_014628080.1| PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] ref|XP_014628081.1| PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] ref|XP_014628082.1| PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] ref|XP_014628083.1| PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] ref|XP_014628084.1| PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] ref|XP_014628085.1| PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] ref|XP_014628086.1| PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] ref|XP_014628087.1| PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] ref|XP_014628088.1| PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] ref|XP_014628089.1| PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] ref|XP_014628090.1| PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] ref|XP_014628091.1| PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] ref|XP_014628092.1| PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] ref|XP_014628093.1| PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] ref|XP_014628094.1| PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] ref|XP_014628095.1| PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] Length = 766 Score = 73.2 bits (178), Expect = 2e-12 Identities = 34/76 (44%), Positives = 49/76 (64%) Frame = +3 Query: 144 VSKLQYECSYSTNYHYQPLKASLALSRKTKCDESQLLHYLRNGWHHEALKILHSFSDRDV 323 + K + Y N H +P K+ ++T+CDES LLHYL NGW ++A +L + S D+ Sbjct: 52 ILKSSFRNVYRIN-HSRPRKSPFPFPKRTECDESLLLHYLSNGWLNDARNLLQNSSGGDL 110 Query: 324 HAHIVRWTSLLANFTR 371 H +VRWTSLL+NF+R Sbjct: 111 HLRVVRWTSLLSNFSR 126 >gb|KRG90497.1| hypothetical protein GLYMA_20G094700 [Glycine max] Length = 894 Score = 73.2 bits (178), Expect = 2e-12 Identities = 34/76 (44%), Positives = 49/76 (64%) Frame = +3 Query: 144 VSKLQYECSYSTNYHYQPLKASLALSRKTKCDESQLLHYLRNGWHHEALKILHSFSDRDV 323 + K + Y N H +P K+ ++T+CDES LLHYL NGW ++A +L + S D+ Sbjct: 52 ILKSSFRNVYRIN-HSRPRKSPFPFPKRTECDESLLLHYLSNGWLNDARNLLQNSSGGDL 110 Query: 324 HAHIVRWTSLLANFTR 371 H +VRWTSLL+NF+R Sbjct: 111 HLRVVRWTSLLSNFSR 126 >ref|XP_004511762.1| PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial [Cicer arietinum] Length = 741 Score = 72.0 bits (175), Expect = 4e-12 Identities = 45/101 (44%), Positives = 53/101 (52%), Gaps = 1/101 (0%) Frame = +3 Query: 72 LRHPPILLR-LMRGSTSTSSLRRFFVSKLQYECSYSTNYHYQPLKASLALSRKTKCDESQ 248 L H PIL LMRGS+ SLRRF +S H K K + DESQ Sbjct: 3 LHHSPILFPPLMRGSSF--SLRRFSLSN-----------HSHSFKPLFPFPPKHEFDESQ 49 Query: 249 LLHYLRNGWHHEALKILHSFSDRDVHAHIVRWTSLLANFTR 371 L HYL G HHEA KIL +F ++ H +V WTSLL N+ R Sbjct: 50 LFHYLTKGLHHEARKILQTFPCKNPHTRVVHWTSLLTNYAR 90 >ref|XP_003611431.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gb|AES94389.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 735 Score = 71.2 bits (173), Expect = 7e-12 Identities = 41/100 (41%), Positives = 55/100 (55%) Frame = +3 Query: 72 LRHPPILLRLMRGSTSTSSLRRFFVSKLQYECSYSTNYHYQPLKASLALSRKTKCDESQL 251 + H PIL++LMR S SLR F + + HY+ CDESQL Sbjct: 5 VHHTPILVQLMR--CSCFSLRSFSLKPRSH-----FPLHYE-------------CDESQL 44 Query: 252 LHYLRNGWHHEALKILHSFSDRDVHAHIVRWTSLLANFTR 371 LHYL NG+ HEA ILHSF ++H+ +V WTS+L N+ + Sbjct: 45 LHYLTNGFLHEARTILHSFPSGNIHSRVVHWTSMLTNYAK 84 >gb|KHN42634.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 461 Score = 67.0 bits (162), Expect = 2e-10 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = +3 Query: 237 DESQLLHYLRNGWHHEALKILHSFSDRDVHAHIVRWTSLLANFTR 371 DES LLHYL NGWH +A +L + S D+H+H+VRWTSLL+NF+R Sbjct: 23 DESLLLHYLSNGWHDDARNLLQNSSGGDLHSHVVRWTSLLSNFSR 67 >gb|KRH77249.1| hypothetical protein GLYMA_01G201800 [Glycine max] Length = 687 Score = 67.0 bits (162), Expect = 2e-10 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = +3 Query: 237 DESQLLHYLRNGWHHEALKILHSFSDRDVHAHIVRWTSLLANFTR 371 DES LLHYL NGWH +A +L + S D+H+H+VRWTSLL+NF+R Sbjct: 23 DESLLLHYLSNGWHDDARNLLQNSSGGDLHSHVVRWTSLLSNFSR 67 >gb|PNY05497.1| pentatricopeptide repeat-containing protein at4g02750-like protein [Trifolium pratense] Length = 743 Score = 67.0 bits (162), Expect = 2e-10 Identities = 40/102 (39%), Positives = 54/102 (52%), Gaps = 1/102 (0%) Frame = +3 Query: 69 PLRHPPILLRLMRGSTSTSSLRRFFVSKLQYECSYSTNYHYQPLKASLALSRKT-KCDES 245 PL H IL+R +S ++RRF ++ N H Q K + +CDES Sbjct: 6 PLHHSAILIR-----SSCLNIRRFSLA----------NNHSQSFKPAFPFPPNNYQCDES 50 Query: 246 QLLHYLRNGWHHEALKILHSFSDRDVHAHIVRWTSLLANFTR 371 QLLHYL G HEA +LH F ++H +VRWTSLL N+ + Sbjct: 51 QLLHYLTKGLLHEARNMLHYFPYGNLHRRVVRWTSLLTNYAK 92 >ref|XP_007156631.1| hypothetical protein PHAVU_002G004400g [Phaseolus vulgaris] gb|ESW28625.1| hypothetical protein PHAVU_002G004400g [Phaseolus vulgaris] Length = 718 Score = 66.6 bits (161), Expect = 3e-10 Identities = 29/47 (61%), Positives = 36/47 (76%) Frame = +3 Query: 231 KCDESQLLHYLRNGWHHEALKILHSFSDRDVHAHIVRWTSLLANFTR 371 +CDE LLHYL NG HH+A +L S S D+HA +VRWTSLL+NF+R Sbjct: 32 ECDEPLLLHYLSNGCHHQARNLLQSSSGGDLHARVVRWTSLLSNFSR 78 >ref|XP_017427849.1| PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Vigna angularis] ref|XP_017427850.1| PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Vigna angularis] gb|KOM44876.1| hypothetical protein LR48_Vigan06g018200 [Vigna angularis] dbj|BAU00380.1| hypothetical protein VIGAN_10196700 [Vigna angularis var. angularis] Length = 718 Score = 65.9 bits (159), Expect = 6e-10 Identities = 29/47 (61%), Positives = 35/47 (74%) Frame = +3 Query: 231 KCDESQLLHYLRNGWHHEALKILHSFSDRDVHAHIVRWTSLLANFTR 371 +CDE LLHYL NG HHEA +L S S D+HA +VRWT LL+NF+R Sbjct: 32 ECDEPLLLHYLSNGCHHEARNLLQSSSRGDLHARVVRWTKLLSNFSR 78 >dbj|BAU00371.1| hypothetical protein VIGAN_10195800 [Vigna angularis var. angularis] Length = 718 Score = 65.1 bits (157), Expect = 1e-09 Identities = 28/47 (59%), Positives = 35/47 (74%) Frame = +3 Query: 231 KCDESQLLHYLRNGWHHEALKILHSFSDRDVHAHIVRWTSLLANFTR 371 +CDE LLHYL NG HHEA +L + S D+HA +VRWT LL+NF+R Sbjct: 32 ECDEPLLLHYLSNGCHHEARNLLQNSSGGDLHARVVRWTKLLSNFSR 78 >ref|XP_014521217.1| pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Vigna radiata var. radiata] Length = 718 Score = 65.1 bits (157), Expect = 1e-09 Identities = 28/47 (59%), Positives = 35/47 (74%) Frame = +3 Query: 231 KCDESQLLHYLRNGWHHEALKILHSFSDRDVHAHIVRWTSLLANFTR 371 +CDE LLHYL NG HHEA +L + S D+HA +VRWT LL+NF+R Sbjct: 32 ECDEPLLLHYLSNGCHHEARNLLQNSSGGDLHARVVRWTKLLSNFSR 78 >ref|XP_014520925.1| pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like isoform X1 [Vigna radiata var. radiata] ref|XP_022631556.1| pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like isoform X1 [Vigna radiata var. radiata] Length = 718 Score = 65.1 bits (157), Expect = 1e-09 Identities = 28/47 (59%), Positives = 35/47 (74%) Frame = +3 Query: 231 KCDESQLLHYLRNGWHHEALKILHSFSDRDVHAHIVRWTSLLANFTR 371 +CDE LLHYL NG HHEA +L + S D+HA +VRWT LL+NF+R Sbjct: 32 ECDEPLLLHYLSNGCHHEARNLLQNSSGGDLHARVVRWTKLLSNFSR 78 >ref|XP_017423737.1| PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Vigna angularis] Length = 196 Score = 62.0 bits (149), Expect = 3e-09 Identities = 27/47 (57%), Positives = 34/47 (72%) Frame = +3 Query: 231 KCDESQLLHYLRNGWHHEALKILHSFSDRDVHAHIVRWTSLLANFTR 371 +CDE LLHYL NG HHEA +L + S D+ A +VRWT LL+NF+R Sbjct: 42 ECDEPLLLHYLSNGCHHEARNLLQNSSGGDLQARVVRWTKLLSNFSR 88 >gb|KOM54794.1| hypothetical protein LR48_Vigan10g068600 [Vigna angularis] Length = 244 Score = 62.0 bits (149), Expect = 6e-09 Identities = 27/47 (57%), Positives = 34/47 (72%) Frame = +3 Query: 231 KCDESQLLHYLRNGWHHEALKILHSFSDRDVHAHIVRWTSLLANFTR 371 +CDE LLHYL NG HHEA +L + S D+ A +VRWT LL+NF+R Sbjct: 42 ECDEPLLLHYLSNGCHHEARNLLQNSSGGDLQARVVRWTKLLSNFSR 88 >ref|XP_017439682.1| PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Vigna angularis] Length = 415 Score = 62.0 bits (149), Expect = 1e-08 Identities = 27/47 (57%), Positives = 34/47 (72%) Frame = +3 Query: 231 KCDESQLLHYLRNGWHHEALKILHSFSDRDVHAHIVRWTSLLANFTR 371 +CDE LLHYL NG HHEA +L + S D+ A +VRWT LL+NF+R Sbjct: 42 ECDEPLLLHYLSNGCHHEARNLLQNSSGGDLQARVVRWTKLLSNFSR 88 >ref|XP_017427263.1| PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Vigna angularis] gb|KOM44883.1| hypothetical protein LR48_Vigan06g018900 [Vigna angularis] Length = 718 Score = 62.0 bits (149), Expect = 1e-08 Identities = 27/47 (57%), Positives = 34/47 (72%) Frame = +3 Query: 231 KCDESQLLHYLRNGWHHEALKILHSFSDRDVHAHIVRWTSLLANFTR 371 +CDE LLHYL NG HHEA +L + S D+ A +VRWT LL+NF+R Sbjct: 32 ECDEPLLLHYLSNGCHHEARNLLQNSSGGDLQARVVRWTKLLSNFSR 78 >gb|KRH76357.1| hypothetical protein GLYMA_01G147900 [Glycine max] Length = 626 Score = 60.5 bits (145), Expect = 4e-08 Identities = 29/63 (46%), Positives = 42/63 (66%), Gaps = 1/63 (1%) Frame = +3 Query: 186 HYQPLKASLALSRKT-KCDESQLLHYLRNGWHHEALKILHSFSDRDVHAHIVRWTSLLAN 362 H++P +LA + + S LLHYL NGWH +A +L + S D+H+ +VRWTSLL+N Sbjct: 27 HWEPFADALANAPSPQRLLLSLLLHYLSNGWHDDARNLLQNSSGGDLHSRVVRWTSLLSN 86 Query: 363 FTR 371 F+R Sbjct: 87 FSR 89 >ref|XP_016175852.1| pentatricopeptide repeat-containing protein At1g32415, mitochondrial [Arachis ipaensis] ref|XP_020968112.1| pentatricopeptide repeat-containing protein At1g32415, mitochondrial [Arachis ipaensis] ref|XP_020968113.1| pentatricopeptide repeat-containing protein At1g32415, mitochondrial [Arachis ipaensis] Length = 732 Score = 60.5 bits (145), Expect = 4e-08 Identities = 34/87 (39%), Positives = 50/87 (57%), Gaps = 4/87 (4%) Frame = +3 Query: 123 SSLRRFFVSKLQYECSYSTNYHYQPLKASLALSRKT----KCDESQLLHYLRNGWHHEAL 290 S+LR F +S + +++ +YH QP +L R + +++ LL YL NGWHHEA Sbjct: 4 STLRYFPLSNVTR--NHNLHYHSQPFNHALPFFRTKGPTLEFNDTLLLRYLSNGWHHEAR 61 Query: 291 KILHSFSDRDVHAHIVRWTSLLANFTR 371 +L+ S HA IV WTSLL ++R Sbjct: 62 DLLYKSSRGHPHARIVHWTSLLTKYSR 88