BLASTX nr result
ID: Astragalus22_contig00037680
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00037680 (526 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004485875.1| PREDICTED: pentatricopeptide repeat-containi... 135 6e-34 gb|KHN18924.1| Pentatricopeptide repeat-containing protein, mito... 124 4e-30 gb|KRH10989.1| hypothetical protein GLYMA_15G080700 [Glycine max] 124 4e-30 ref|XP_020205067.1| pentatricopeptide repeat-containing protein ... 122 4e-29 ref|XP_003593731.1| pentatricopeptide (PPR) repeat protein [Medi... 121 6e-29 ref|XP_014518000.1| pentatricopeptide repeat-containing protein ... 120 2e-28 ref|XP_017435574.1| PREDICTED: pentatricopeptide repeat-containi... 115 9e-27 ref|XP_017435573.1| PREDICTED: pentatricopeptide repeat-containi... 115 1e-26 ref|XP_007148069.1| hypothetical protein PHAVU_006G178000g [Phas... 114 2e-26 ref|XP_003541711.1| PREDICTED: pentatricopeptide repeat-containi... 114 3e-26 ref|XP_019426182.1| PREDICTED: pentatricopeptide repeat-containi... 89 2e-17 gb|OMO65345.1| hypothetical protein COLO4_31336 [Corchorus olito... 87 2e-16 ref|XP_007212512.1| pentatricopeptide repeat-containing protein ... 83 2e-15 ref|XP_008225203.1| PREDICTED: pentatricopeptide repeat-containi... 83 3e-15 ref|XP_021598104.1| pentatricopeptide repeat-containing protein ... 82 5e-15 gb|EOY28063.1| Tetratricopeptide repeat (TPR)-like superfamily p... 82 6e-15 ref|XP_021294432.1| pentatricopeptide repeat-containing protein ... 82 8e-15 ref|XP_002305756.1| hypothetical protein POPTR_0004s05320g [Popu... 81 2e-14 gb|PNT39701.1| hypothetical protein POPTR_004G054000v3 [Populus ... 81 2e-14 gb|POF20090.1| pentatricopeptide repeat-containing protein, mito... 80 3e-14 >ref|XP_004485875.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Cicer arietinum] Length = 525 Score = 135 bits (339), Expect = 6e-34 Identities = 64/82 (78%), Positives = 72/82 (87%), Gaps = 3/82 (3%) Frame = -2 Query: 237 LNNGVFRTFFLCRSIH---ISPHQPFPQNHNFVPHSTLLSNSLQHSINSETPSHGQRIHS 67 +NNG+FR FFL RS H ISPHQPF QNH+F+PHS+ LSN+LQH I S+TPSHGQ+IHS Sbjct: 1 MNNGIFRPFFLSRSFHSSLISPHQPFLQNHDFIPHSSFLSNTLQHYIYSQTPSHGQKIHS 60 Query: 66 HILKTGFVPNTNISIKLLILYL 1 HILKTGFVPNTNISIKLLILYL Sbjct: 61 HILKTGFVPNTNISIKLLILYL 82 >gb|KHN18924.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 493 Score = 124 bits (311), Expect = 4e-30 Identities = 61/82 (74%), Positives = 67/82 (81%), Gaps = 3/82 (3%) Frame = -2 Query: 237 LNNGVFRTFFLCRSI---HISPHQPFPQNHNFVPHSTLLSNSLQHSINSETPSHGQRIHS 67 +NNG+FR FF R ISPHQPFPQNH+FVP STL SN+LQH INSETPSHGQ+IHS Sbjct: 1 MNNGIFRPFFSSRGFCTSFISPHQPFPQNHDFVPPSTLFSNALQHYINSETPSHGQKIHS 60 Query: 66 HILKTGFVPNTNISIKLLILYL 1 ILK+GFV N NISIKLLILYL Sbjct: 61 RILKSGFVSNANISIKLLILYL 82 >gb|KRH10989.1| hypothetical protein GLYMA_15G080700 [Glycine max] Length = 504 Score = 124 bits (311), Expect = 4e-30 Identities = 61/82 (74%), Positives = 67/82 (81%), Gaps = 3/82 (3%) Frame = -2 Query: 237 LNNGVFRTFFLCRSI---HISPHQPFPQNHNFVPHSTLLSNSLQHSINSETPSHGQRIHS 67 +NNG+FR FF R ISPHQPFPQNH+FVP STL SN+LQH INSETPSHGQ+IHS Sbjct: 1 MNNGIFRPFFSSRGFCTSFISPHQPFPQNHDFVPPSTLFSNALQHYINSETPSHGQKIHS 60 Query: 66 HILKTGFVPNTNISIKLLILYL 1 ILK+GFV N NISIKLLILYL Sbjct: 61 RILKSGFVSNANISIKLLILYL 82 >ref|XP_020205067.1| pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Cajanus cajan] Length = 525 Score = 122 bits (305), Expect = 4e-29 Identities = 62/82 (75%), Positives = 68/82 (82%), Gaps = 3/82 (3%) Frame = -2 Query: 237 LNNGVFRTFFLCR---SIHISPHQPFPQNHNFVPHSTLLSNSLQHSINSETPSHGQRIHS 67 +NNG+FR FFL R S ISPH+PF NH+ VP STLLSN+LQH INSETPSHGQ+IHS Sbjct: 1 MNNGIFRYFFLSRGFCSSLISPHKPFSLNHDSVPPSTLLSNALQHYINSETPSHGQKIHS 60 Query: 66 HILKTGFVPNTNISIKLLILYL 1 ILKTGF PNTNISIKLLILYL Sbjct: 61 RILKTGFFPNTNISIKLLILYL 82 >ref|XP_003593731.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gb|AES63982.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 520 Score = 121 bits (303), Expect = 6e-29 Identities = 59/83 (71%), Positives = 67/83 (80%), Gaps = 3/83 (3%) Frame = -2 Query: 240 MLNNGVFRTFFLCR---SIHISPHQPFPQNHNFVPHSTLLSNSLQHSINSETPSHGQRIH 70 M N +FR FF R S +SPHQPF QNH+F+P ST SN+LQH INS+TPSHGQ+IH Sbjct: 1 MKNGIIFRPFFFSRRFLSSLLSPHQPFSQNHDFIPPSTFFSNTLQHYINSQTPSHGQKIH 60 Query: 69 SHILKTGFVPNTNISIKLLILYL 1 SHILKTGFVPNTNISIKLLILY+ Sbjct: 61 SHILKTGFVPNTNISIKLLILYI 83 >ref|XP_014518000.1| pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Vigna radiata var. radiata] Length = 525 Score = 120 bits (300), Expect = 2e-28 Identities = 58/83 (69%), Positives = 70/83 (84%), Gaps = 4/83 (4%) Frame = -2 Query: 237 LNNGVFRTFF----LCRSIHISPHQPFPQNHNFVPHSTLLSNSLQHSINSETPSHGQRIH 70 +NNG+FR FF C S+ +SPH+PFPQNH+F STLLS++LQH INS+TP+HGQ+IH Sbjct: 1 MNNGIFRPFFSSRAFCTSL-VSPHRPFPQNHDFASPSTLLSSALQHYINSDTPTHGQKIH 59 Query: 69 SHILKTGFVPNTNISIKLLILYL 1 S ILK+GFVPNTNISIKLLILYL Sbjct: 60 SRILKSGFVPNTNISIKLLILYL 82 >ref|XP_017435574.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial isoform X2 [Vigna angularis] Length = 497 Score = 115 bits (287), Expect = 9e-27 Identities = 57/83 (68%), Positives = 67/83 (80%), Gaps = 4/83 (4%) Frame = -2 Query: 237 LNNGVFRTFF----LCRSIHISPHQPFPQNHNFVPHSTLLSNSLQHSINSETPSHGQRIH 70 +NNG+FR F C S+ ISPH+PFPQNH+F STLLS +L H INS+TP+HGQ+IH Sbjct: 1 MNNGIFRPFCSSRAFCTSL-ISPHRPFPQNHDFASPSTLLSTALHHYINSDTPTHGQKIH 59 Query: 69 SHILKTGFVPNTNISIKLLILYL 1 S ILK+GFVPNTNISIKLLILYL Sbjct: 60 SRILKSGFVPNTNISIKLLILYL 82 >ref|XP_017435573.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial isoform X1 [Vigna angularis] dbj|BAT87160.1| hypothetical protein VIGAN_05050200 [Vigna angularis var. angularis] Length = 525 Score = 115 bits (287), Expect = 1e-26 Identities = 57/83 (68%), Positives = 67/83 (80%), Gaps = 4/83 (4%) Frame = -2 Query: 237 LNNGVFRTFF----LCRSIHISPHQPFPQNHNFVPHSTLLSNSLQHSINSETPSHGQRIH 70 +NNG+FR F C S+ ISPH+PFPQNH+F STLLS +L H INS+TP+HGQ+IH Sbjct: 1 MNNGIFRPFCSSRAFCTSL-ISPHRPFPQNHDFASPSTLLSTALHHYINSDTPTHGQKIH 59 Query: 69 SHILKTGFVPNTNISIKLLILYL 1 S ILK+GFVPNTNISIKLLILYL Sbjct: 60 SRILKSGFVPNTNISIKLLILYL 82 >ref|XP_007148069.1| hypothetical protein PHAVU_006G178000g [Phaseolus vulgaris] gb|ESW20063.1| hypothetical protein PHAVU_006G178000g [Phaseolus vulgaris] Length = 497 Score = 114 bits (285), Expect = 2e-26 Identities = 57/83 (68%), Positives = 68/83 (81%), Gaps = 4/83 (4%) Frame = -2 Query: 237 LNNGVFRTFF----LCRSIHISPHQPFPQNHNFVPHSTLLSNSLQHSINSETPSHGQRIH 70 +NN +FR FF C S+ ISPH+PFPQN++F STLLS +LQH INS+TP+HGQ+IH Sbjct: 1 MNNEIFRPFFSSRAFCTSL-ISPHRPFPQNNDFASPSTLLSTALQHYINSQTPTHGQKIH 59 Query: 69 SHILKTGFVPNTNISIKLLILYL 1 S ILK+GFVPNTNISIKLLILYL Sbjct: 60 SRILKSGFVPNTNISIKLLILYL 82 >ref|XP_003541711.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Glycine max] gb|KRH21311.1| hypothetical protein GLYMA_13G232000 [Glycine max] Length = 525 Score = 114 bits (284), Expect = 3e-26 Identities = 58/83 (69%), Positives = 66/83 (79%), Gaps = 4/83 (4%) Frame = -2 Query: 237 LNNGVFRTFF----LCRSIHISPHQPFPQNHNFVPHSTLLSNSLQHSINSETPSHGQRIH 70 + N +FR FF C S+ IS HQPFPQNH+F+P ST SN+LQ INSETPSHGQ+IH Sbjct: 1 MKNAIFRPFFSSRGFCTSL-ISHHQPFPQNHDFIPPSTSFSNALQLYINSETPSHGQKIH 59 Query: 69 SHILKTGFVPNTNISIKLLILYL 1 S ILK+GFVPNTNISIKLLILYL Sbjct: 60 SSILKSGFVPNTNISIKLLILYL 82 >ref|XP_019426182.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Lupinus angustifolius] Length = 518 Score = 89.0 bits (219), Expect = 2e-17 Identities = 45/57 (78%), Positives = 50/57 (87%), Gaps = 1/57 (1%) Frame = -2 Query: 168 PQNH-NFVPHSTLLSNSLQHSINSETPSHGQRIHSHILKTGFVPNTNISIKLLILYL 1 P NH + +P STLLSN+LQH INS++PS GQ IHSHILKTGFVPNTNISIKLLILYL Sbjct: 19 PHNHVSLLPLSTLLSNTLQHYINSDSPSIGQTIHSHILKTGFVPNTNISIKLLILYL 75 >gb|OMO65345.1| hypothetical protein COLO4_31336 [Corchorus olitorius] Length = 560 Score = 86.7 bits (213), Expect = 2e-16 Identities = 42/70 (60%), Positives = 56/70 (80%), Gaps = 3/70 (4%) Frame = -2 Query: 201 RSIHISPHQPFPQ-NHNFV--PHSTLLSNSLQHSINSETPSHGQRIHSHILKTGFVPNTN 31 R+ + + FP +HN++ P ST LS++LQH INS+TPSHGQ+IH+HI+KTGF PNTN Sbjct: 20 RNFLVPTNNAFPAVDHNYLSNPTSTTLSSALQHFINSDTPSHGQKIHAHIIKTGFSPNTN 79 Query: 30 ISIKLLILYL 1 +SIKLLI+YL Sbjct: 80 VSIKLLIIYL 89 >ref|XP_007212512.1| pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Prunus persica] gb|ONI10629.1| hypothetical protein PRUPE_4G058100 [Prunus persica] Length = 527 Score = 83.2 bits (204), Expect = 2e-15 Identities = 39/63 (61%), Positives = 50/63 (79%) Frame = -2 Query: 189 ISPHQPFPQNHNFVPHSTLLSNSLQHSINSETPSHGQRIHSHILKTGFVPNTNISIKLLI 10 + P+ FP ++ P +T L++SLQH INSE PSHGQ+IH+HILKTGF PN N+SIKLLI Sbjct: 24 VPPNPVFPPSYVASPIATTLASSLQHYINSENPSHGQKIHTHILKTGFRPNINVSIKLLI 83 Query: 9 LYL 1 L+L Sbjct: 84 LHL 86 >ref|XP_008225203.1| PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Prunus mume] Length = 527 Score = 82.8 bits (203), Expect = 3e-15 Identities = 39/63 (61%), Positives = 50/63 (79%) Frame = -2 Query: 189 ISPHQPFPQNHNFVPHSTLLSNSLQHSINSETPSHGQRIHSHILKTGFVPNTNISIKLLI 10 + P+ FP ++ P +T L++SLQH INSE PSHGQ+IH+HILKTGF PN N+SIKLLI Sbjct: 24 VPPNPVFPLSYVASPIATTLASSLQHYINSENPSHGQKIHTHILKTGFRPNINVSIKLLI 83 Query: 9 LYL 1 L+L Sbjct: 84 LHL 86 >ref|XP_021598104.1| pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Manihot esculenta] ref|XP_021598105.1| pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Manihot esculenta] ref|XP_021598106.1| pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Manihot esculenta] ref|XP_021598107.1| pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Manihot esculenta] ref|XP_021598108.1| pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Manihot esculenta] ref|XP_021598109.1| pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Manihot esculenta] gb|OAY26293.1| hypothetical protein MANES_16G036200 [Manihot esculenta] Length = 546 Score = 82.4 bits (202), Expect = 5e-15 Identities = 43/67 (64%), Positives = 53/67 (79%), Gaps = 3/67 (4%) Frame = -2 Query: 192 HISPHQPFPQN--HNFVP-HSTLLSNSLQHSINSETPSHGQRIHSHILKTGFVPNTNISI 22 H SPHQ FPQN HN + ++T LS+ LQ INS+ P +GQ+IH+HILK+GF+PNTNISI Sbjct: 23 HGSPHQIFPQNEDHNSIHCNATTLSSVLQRYINSDNPFYGQKIHAHILKSGFIPNTNISI 82 Query: 21 KLLILYL 1 KLLIL L Sbjct: 83 KLLILNL 89 >gb|EOY28063.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 532 Score = 82.0 bits (201), Expect = 6e-15 Identities = 39/69 (56%), Positives = 54/69 (78%), Gaps = 3/69 (4%) Frame = -2 Query: 201 RSIHISPHQPF-PQNHNFV--PHSTLLSNSLQHSINSETPSHGQRIHSHILKTGFVPNTN 31 ++ ++P F P +HNF+ P +T LS +LQH INS+TP HGQ+IH+HI+K+GF PNTN Sbjct: 20 QNFRVAPKNSFAPNHHNFLSNPTTTTLSAALQHFINSDTPFHGQKIHTHIIKSGFSPNTN 79 Query: 30 ISIKLLILY 4 +SIKLLIL+ Sbjct: 80 VSIKLLILH 88 >ref|XP_021294432.1| pentatricopeptide repeat-containing protein At1g28690, mitochondrial [Herrania umbratica] Length = 532 Score = 81.6 bits (200), Expect = 8e-15 Identities = 37/58 (63%), Positives = 50/58 (86%), Gaps = 2/58 (3%) Frame = -2 Query: 168 PQNHNFV--PHSTLLSNSLQHSINSETPSHGQRIHSHILKTGFVPNTNISIKLLILYL 1 P +HN++ P +T LS++LQH INS+TP HGQ+IH+HI+K+GF PNTN+SIKLLIL+L Sbjct: 32 PNHHNYLSNPTATTLSSALQHFINSDTPFHGQKIHTHIIKSGFSPNTNVSIKLLILHL 89 >ref|XP_002305756.1| hypothetical protein POPTR_0004s05320g [Populus trichocarpa] Length = 530 Score = 80.9 bits (198), Expect = 2e-14 Identities = 41/71 (57%), Positives = 51/71 (71%), Gaps = 3/71 (4%) Frame = -2 Query: 204 CRSIHISPHQPFPQNH-NFVPHST--LLSNSLQHSINSETPSHGQRIHSHILKTGFVPNT 34 C + P FP N +++ H T LS++LQH INS+TP HGQ+IH+HILKTGF PN Sbjct: 18 CNYTSLRPSNVFPPNQEDYITHQTPTTLSSALQHYINSDTPFHGQKIHTHILKTGFRPNI 77 Query: 33 NISIKLLILYL 1 NISIKLLIL+L Sbjct: 78 NISIKLLILHL 88 >gb|PNT39701.1| hypothetical protein POPTR_004G054000v3 [Populus trichocarpa] Length = 568 Score = 80.9 bits (198), Expect = 2e-14 Identities = 41/71 (57%), Positives = 51/71 (71%), Gaps = 3/71 (4%) Frame = -2 Query: 204 CRSIHISPHQPFPQNH-NFVPHST--LLSNSLQHSINSETPSHGQRIHSHILKTGFVPNT 34 C + P FP N +++ H T LS++LQH INS+TP HGQ+IH+HILKTGF PN Sbjct: 56 CNYTSLRPSNVFPPNQEDYITHQTPTTLSSALQHYINSDTPFHGQKIHTHILKTGFRPNI 115 Query: 33 NISIKLLILYL 1 NISIKLLIL+L Sbjct: 116 NISIKLLILHL 126 >gb|POF20090.1| pentatricopeptide repeat-containing protein, mitochondrial [Quercus suber] Length = 370 Score = 79.7 bits (195), Expect = 3e-14 Identities = 40/65 (61%), Positives = 50/65 (76%), Gaps = 2/65 (3%) Frame = -2 Query: 189 ISPHQPFPQNHNFVPH--STLLSNSLQHSINSETPSHGQRIHSHILKTGFVPNTNISIKL 16 + P+Q FP + H +T LS++LQ INS+ PS+GQ+IHSHILKTGF PNTNISIKL Sbjct: 24 VPPNQTFPPTQDSFSHPTATSLSSALQQYINSDNPSYGQKIHSHILKTGFRPNTNISIKL 83 Query: 15 LILYL 1 LIL+L Sbjct: 84 LILHL 88