BLASTX nr result
ID: Astragalus22_contig00037451
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00037451 (307 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004500526.1| PREDICTED: protein FAR1-RELATED SEQUENCE 6-l... 58 2e-07 >ref|XP_004500526.1| PREDICTED: protein FAR1-RELATED SEQUENCE 6-like [Cicer arietinum] Length = 853 Score = 57.8 bits (138), Expect = 2e-07 Identities = 26/54 (48%), Positives = 33/54 (61%) Frame = -2 Query: 306 ISILHVNDIHWVHVALLTECPLPPIGFQWECFSSNEANSWLDLYMGRFQLWVSL 145 ISI VN+ HWV V L CPLPP+ + W+ + S+E+ SW Y R Q W SL Sbjct: 786 ISIGFVNESHWVQVKLKFACPLPPLAWHWKKYRSDESTSWAIAYTRRLQHWGSL 839