BLASTX nr result
ID: Astragalus22_contig00037365
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00037365 (369 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU14768.1| hypothetical protein TSUD_204170 [Trifolium subt... 59 1e-07 dbj|GAU25827.1| hypothetical protein TSUD_30910 [Trifolium subte... 54 8e-07 gb|ABE80156.1| Ribonuclease H [Medicago truncatula] 55 2e-06 gb|PNX92765.1| ribonuclease H [Trifolium pratense] 55 5e-06 >dbj|GAU14768.1| hypothetical protein TSUD_204170 [Trifolium subterraneum] Length = 503 Score = 58.9 bits (141), Expect = 1e-07 Identities = 23/44 (52%), Positives = 30/44 (68%) Frame = +2 Query: 2 SWLLRKRYDDLNFCATPSWKWIWNIEGPKKVKLLLWTACHNLIP 133 SWLL+K+ + N SWKWIWN+ P+K+K L+W CHN IP Sbjct: 262 SWLLKKKQHNPN---NKSWKWIWNLRAPEKIKFLIWCICHNSIP 302 >dbj|GAU25827.1| hypothetical protein TSUD_30910 [Trifolium subterraneum] Length = 592 Score = 53.5 bits (127), Expect(2) = 8e-07 Identities = 21/47 (44%), Positives = 28/47 (59%) Frame = +2 Query: 2 SWLLRKRYDDLNFCATPSWKWIWNIEGPKKVKLLLWTACHNLIPIAS 142 +WLL R +N + SW WIW I+ P+K+K W ACHN +P S Sbjct: 280 NWLLSLRDLVINHNPSHSWSWIWKIQLPEKIKFFFWLACHNFVPTLS 326 Score = 26.9 bits (58), Expect(2) = 8e-07 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 241 IGFNNQLLFDIHDVGVWLNLGIT 309 IGFNN F DV WL LG T Sbjct: 366 IGFNNMDFFSNMDVYDWLKLGAT 388 >gb|ABE80156.1| Ribonuclease H [Medicago truncatula] Length = 438 Score = 55.5 bits (132), Expect = 2e-06 Identities = 21/46 (45%), Positives = 28/46 (60%) Frame = +2 Query: 5 WLLRKRYDDLNFCATPSWKWIWNIEGPKKVKLLLWTACHNLIPIAS 142 WLL R + PSW WIWN++ P+K K L+W AC N++P S Sbjct: 103 WLLTFRVPATDIIPHPSWSWIWNLQVPEKYKFLIWLACQNVVPTLS 148 >gb|PNX92765.1| ribonuclease H [Trifolium pratense] Length = 1310 Score = 54.7 bits (130), Expect = 5e-06 Identities = 20/43 (46%), Positives = 30/43 (69%) Frame = +2 Query: 5 WLLRKRYDDLNFCATPSWKWIWNIEGPKKVKLLLWTACHNLIP 133 WLL+++Y N + SW WIW ++ P+K+K L+W ACH+ IP Sbjct: 978 WLLQQKY---NVPSIQSWNWIWKLQAPEKIKFLIWCACHHSIP 1017