BLASTX nr result
ID: Astragalus22_contig00037081
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00037081 (347 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KYP58620.1| Interactor of constitutive active ROPs 3 [Cajanus... 67 2e-10 ref|XP_020224418.1| interactor of constitutive active ROPs 3-lik... 67 2e-10 ref|XP_014498088.1| interactor of constitutive active ROPs 3 [Vi... 66 3e-10 ref|XP_017422986.1| PREDICTED: interactor of constitutive active... 66 3e-10 ref|XP_006594993.1| PREDICTED: interactor of constitutive active... 65 1e-09 ref|XP_007150230.1| hypothetical protein PHAVU_005G137600g [Phas... 64 1e-09 gb|KHN22038.1| Interactor of constitutive active ROPs 3 [Glycine... 63 4e-09 ref|XP_014628594.1| PREDICTED: interactor of constitutive active... 63 4e-09 ref|XP_003538038.1| PREDICTED: interactor of constitutive active... 63 4e-09 gb|KRG89052.1| hypothetical protein GLYMA_U021100 [Glycine max] 63 4e-09 ref|XP_006597313.1| PREDICTED: interactor of constitutive active... 62 1e-08 gb|KHN33445.1| Interactor of constitutive active ROPs 3 [Glycine... 62 1e-08 ref|XP_003597154.1| interactor of constitutive active ROPs-like ... 60 3e-08 gb|KHN05714.1| Interactor of constitutive active ROPs 3 [Glycine... 58 3e-07 ref|XP_006592232.1| PREDICTED: interactor of constitutive active... 58 3e-07 ref|XP_003539735.1| PREDICTED: interactor of constitutive active... 58 3e-07 gb|PNX76294.1| Interactor of constitutive active ROPs, partial [... 57 7e-07 ref|XP_015952353.1| interactor of constitutive active ROPs 3 [Ar... 57 7e-07 ref|XP_016187376.1| interactor of constitutive active ROPs 3 [Ar... 55 2e-06 gb|KHN30239.1| Interactor of constitutive active ROPs 3 [Glycine... 54 4e-06 >gb|KYP58620.1| Interactor of constitutive active ROPs 3 [Cajanus cajan] Length = 588 Score = 66.6 bits (161), Expect = 2e-10 Identities = 41/78 (52%), Positives = 53/78 (67%), Gaps = 5/78 (6%) Frame = -3 Query: 288 ILNNNFCSFLPLKHNFSQSLSMVE-----IENMKESYQSQAHALVNETLKQLEVAKRTVE 124 I ++ L LK N ++SLS+VE + + KES Q+QA LVNETL+QLE AKRTVE Sbjct: 195 IAESSDVELLNLKDNLAESLSLVENMKNQLRDSKESVQAQA--LVNETLRQLEAAKRTVE 252 Query: 123 FLRAADTKKAMHGYDKCS 70 FLR AD KA+HGY+ + Sbjct: 253 FLR-ADAAKAVHGYNSAA 269 >ref|XP_020224418.1| interactor of constitutive active ROPs 3-like [Cajanus cajan] ref|XP_020224419.1| interactor of constitutive active ROPs 3-like [Cajanus cajan] ref|XP_020224420.1| interactor of constitutive active ROPs 3-like [Cajanus cajan] ref|XP_020224421.1| interactor of constitutive active ROPs 3-like [Cajanus cajan] ref|XP_020224422.1| interactor of constitutive active ROPs 3-like [Cajanus cajan] Length = 612 Score = 66.6 bits (161), Expect = 2e-10 Identities = 41/78 (52%), Positives = 53/78 (67%), Gaps = 5/78 (6%) Frame = -3 Query: 288 ILNNNFCSFLPLKHNFSQSLSMVE-----IENMKESYQSQAHALVNETLKQLEVAKRTVE 124 I ++ L LK N ++SLS+VE + + KES Q+QA LVNETL+QLE AKRTVE Sbjct: 195 IAESSDVELLNLKDNLAESLSLVENMKNQLRDSKESVQAQA--LVNETLRQLEAAKRTVE 252 Query: 123 FLRAADTKKAMHGYDKCS 70 FLR AD KA+HGY+ + Sbjct: 253 FLR-ADAAKAVHGYNSAA 269 >ref|XP_014498088.1| interactor of constitutive active ROPs 3 [Vigna radiata var. radiata] ref|XP_014498089.1| interactor of constitutive active ROPs 3 [Vigna radiata var. radiata] ref|XP_022635398.1| interactor of constitutive active ROPs 3 [Vigna radiata var. radiata] Length = 616 Score = 66.2 bits (160), Expect = 3e-10 Identities = 41/78 (52%), Positives = 51/78 (65%), Gaps = 5/78 (6%) Frame = -3 Query: 288 ILNNNFCSFLPLKHNFSQSLSMVEIENMKESYQS-----QAHALVNETLKQLEVAKRTVE 124 I ++ L LK N ++SLS+VE NMK + QA ALVNETL+QLE AKRTVE Sbjct: 198 IAESSDVELLNLKDNLAESLSLVE--NMKNQLRDSKESGQAQALVNETLRQLEAAKRTVE 255 Query: 123 FLRAADTKKAMHGYDKCS 70 FLR AD KA+HGY+ + Sbjct: 256 FLR-ADAAKAVHGYNSAA 272 >ref|XP_017422986.1| PREDICTED: interactor of constitutive active ROPs 3-like [Vigna angularis] ref|XP_017422988.1| PREDICTED: interactor of constitutive active ROPs 3-like [Vigna angularis] ref|XP_017422989.1| PREDICTED: interactor of constitutive active ROPs 3-like [Vigna angularis] ref|XP_017422990.1| PREDICTED: interactor of constitutive active ROPs 3-like [Vigna angularis] ref|XP_017422993.1| PREDICTED: interactor of constitutive active ROPs 3-like [Vigna angularis] ref|XP_017422994.1| PREDICTED: interactor of constitutive active ROPs 3-like [Vigna angularis] ref|XP_017422995.1| PREDICTED: interactor of constitutive active ROPs 3-like [Vigna angularis] ref|XP_017422996.1| PREDICTED: interactor of constitutive active ROPs 3-like [Vigna angularis] gb|KOM44222.1| hypothetical protein LR48_Vigan05g182700 [Vigna angularis] gb|KOM44223.1| hypothetical protein LR48_Vigan05g182800 [Vigna angularis] dbj|BAT91937.1| hypothetical protein VIGAN_07058100 [Vigna angularis var. angularis] Length = 616 Score = 66.2 bits (160), Expect = 3e-10 Identities = 41/78 (52%), Positives = 51/78 (65%), Gaps = 5/78 (6%) Frame = -3 Query: 288 ILNNNFCSFLPLKHNFSQSLSMVEIENMKESYQS-----QAHALVNETLKQLEVAKRTVE 124 I ++ L LK N ++SLS+VE NMK + QA ALVNETL+QLE AKRTVE Sbjct: 198 IAESSDVELLNLKDNLAESLSLVE--NMKNQLRDSKESGQAQALVNETLRQLEAAKRTVE 255 Query: 123 FLRAADTKKAMHGYDKCS 70 FLR AD KA+HGY+ + Sbjct: 256 FLR-ADAAKAVHGYNSAA 272 >ref|XP_006594993.1| PREDICTED: interactor of constitutive active ROPs 3-like [Glycine max] gb|KRH22942.1| hypothetical protein GLYMA_13G328900 [Glycine max] Length = 614 Score = 64.7 bits (156), Expect = 1e-09 Identities = 43/97 (44%), Positives = 60/97 (61%), Gaps = 3/97 (3%) Frame = -3 Query: 288 ILNNNFCSFLPLKHNFSQSLSMVEI--ENMKESYQS-QAHALVNETLKQLEVAKRTVEFL 118 I ++ L LK N ++SLS+VE +K+S +S QA ALVNETL+QLE AKRTVEFL Sbjct: 199 IAESSDVELLNLKDNLAESLSLVENMKNQLKDSKESAQAQALVNETLRQLEAAKRTVEFL 258 Query: 117 RAADTKKAMHGYDKCSCYKQEGERLENGDKDNANHIE 7 R AD KA++GY+ S + N ++ + +E Sbjct: 259 R-ADAAKAVNGYNFASLELDQSRARVNSLEELVSKLE 294 >ref|XP_007150230.1| hypothetical protein PHAVU_005G137600g [Phaseolus vulgaris] ref|XP_007150231.1| hypothetical protein PHAVU_005G137600g [Phaseolus vulgaris] ref|XP_007150232.1| hypothetical protein PHAVU_005G137600g [Phaseolus vulgaris] ref|XP_007150233.1| hypothetical protein PHAVU_005G137600g [Phaseolus vulgaris] gb|ESW22224.1| hypothetical protein PHAVU_005G137600g [Phaseolus vulgaris] gb|ESW22225.1| hypothetical protein PHAVU_005G137600g [Phaseolus vulgaris] gb|ESW22226.1| hypothetical protein PHAVU_005G137600g [Phaseolus vulgaris] gb|ESW22227.1| hypothetical protein PHAVU_005G137600g [Phaseolus vulgaris] Length = 613 Score = 64.3 bits (155), Expect = 1e-09 Identities = 39/78 (50%), Positives = 51/78 (65%), Gaps = 5/78 (6%) Frame = -3 Query: 288 ILNNNFCSFLPLKHNFSQSLSMVEIENMKESYQS-----QAHALVNETLKQLEVAKRTVE 124 I ++ L LK N ++SL++VE NMK + QA ALVNETL+QLE AKRTVE Sbjct: 197 IAESSDVELLNLKDNLAESLTLVE--NMKNQLRDSKESGQAQALVNETLRQLEAAKRTVE 254 Query: 123 FLRAADTKKAMHGYDKCS 70 FLR +D KA+HGY+ + Sbjct: 255 FLR-SDAAKALHGYNSAA 271 >gb|KHN22038.1| Interactor of constitutive active ROPs 3 [Glycine soja] Length = 615 Score = 63.2 bits (152), Expect = 4e-09 Identities = 41/92 (44%), Positives = 58/92 (63%), Gaps = 5/92 (5%) Frame = -3 Query: 261 LPLKHNFSQSLSMVE-----IENMKESYQSQAHALVNETLKQLEVAKRTVEFLRAADTKK 97 L LK N S++LS+V+ + + KES ++QA ALVNET+ QLE AK TVEFLR AD K Sbjct: 206 LNLKQNLSETLSLVDALKNQLRDCKES-EAQAQALVNETMMQLEAAKGTVEFLR-ADVAK 263 Query: 96 AMHGYDKCSCYKQEGERLENGDKDNANHIETD 1 A+ GY+ + + E N + +++ETD Sbjct: 264 AVDGYNSIAKELDQSEARVNSLEAFVSNLETD 295 >ref|XP_014628594.1| PREDICTED: interactor of constitutive active ROPs 3-like isoform X2 [Glycine max] gb|KRG89053.1| hypothetical protein GLYMA_U021100 [Glycine max] gb|KRG89054.1| hypothetical protein GLYMA_U021100 [Glycine max] gb|KRG89055.1| hypothetical protein GLYMA_U021100 [Glycine max] gb|KRG89056.1| hypothetical protein GLYMA_U021100 [Glycine max] Length = 615 Score = 63.2 bits (152), Expect = 4e-09 Identities = 41/92 (44%), Positives = 58/92 (63%), Gaps = 5/92 (5%) Frame = -3 Query: 261 LPLKHNFSQSLSMVE-----IENMKESYQSQAHALVNETLKQLEVAKRTVEFLRAADTKK 97 L LK N S++LS+V+ + + KES ++QA ALVNET+ QLE AK TVEFLR AD K Sbjct: 206 LNLKQNLSETLSLVDALKNQLRDCKES-EAQAQALVNETMMQLEAAKGTVEFLR-ADVAK 263 Query: 96 AMHGYDKCSCYKQEGERLENGDKDNANHIETD 1 A+ GY+ + + E N + +++ETD Sbjct: 264 AVDGYNSIAKELDQSEARVNSLEALVSNLETD 295 >ref|XP_003538038.1| PREDICTED: interactor of constitutive active ROPs 3-like isoform X1 [Glycine max] ref|XP_006591017.1| PREDICTED: interactor of constitutive active ROPs 3-like isoform X1 [Glycine max] ref|XP_006591018.1| PREDICTED: interactor of constitutive active ROPs 3-like isoform X1 [Glycine max] ref|XP_014628595.1| PREDICTED: interactor of constitutive active ROPs 3-like isoform X1 [Glycine max] gb|KRG89046.1| hypothetical protein GLYMA_U021100 [Glycine max] gb|KRG89047.1| hypothetical protein GLYMA_U021100 [Glycine max] gb|KRG89048.1| hypothetical protein GLYMA_U021100 [Glycine max] gb|KRG89049.1| hypothetical protein GLYMA_U021100 [Glycine max] gb|KRG89050.1| hypothetical protein GLYMA_U021100 [Glycine max] gb|KRG89051.1| hypothetical protein GLYMA_U021100 [Glycine max] Length = 615 Score = 63.2 bits (152), Expect = 4e-09 Identities = 41/92 (44%), Positives = 58/92 (63%), Gaps = 5/92 (5%) Frame = -3 Query: 261 LPLKHNFSQSLSMVE-----IENMKESYQSQAHALVNETLKQLEVAKRTVEFLRAADTKK 97 L LK N S++LS+V+ + + KES ++QA ALVNET+ QLE AK TVEFLR AD K Sbjct: 206 LNLKQNLSETLSLVDALKNQLRDCKES-EAQAQALVNETMMQLEAAKGTVEFLR-ADVAK 263 Query: 96 AMHGYDKCSCYKQEGERLENGDKDNANHIETD 1 A+ GY+ + + E N + +++ETD Sbjct: 264 AVDGYNSIAKELDQSEARVNSLEALVSNLETD 295 >gb|KRG89052.1| hypothetical protein GLYMA_U021100 [Glycine max] Length = 617 Score = 63.2 bits (152), Expect = 4e-09 Identities = 41/92 (44%), Positives = 58/92 (63%), Gaps = 5/92 (5%) Frame = -3 Query: 261 LPLKHNFSQSLSMVE-----IENMKESYQSQAHALVNETLKQLEVAKRTVEFLRAADTKK 97 L LK N S++LS+V+ + + KES ++QA ALVNET+ QLE AK TVEFLR AD K Sbjct: 208 LNLKQNLSETLSLVDALKNQLRDCKES-EAQAQALVNETMMQLEAAKGTVEFLR-ADVAK 265 Query: 96 AMHGYDKCSCYKQEGERLENGDKDNANHIETD 1 A+ GY+ + + E N + +++ETD Sbjct: 266 AVDGYNSIAKELDQSEARVNSLEALVSNLETD 297 >ref|XP_006597313.1| PREDICTED: interactor of constitutive active ROPs 3-like [Glycine max] ref|XP_006597314.1| PREDICTED: interactor of constitutive active ROPs 3-like [Glycine max] gb|KRH10403.1| hypothetical protein GLYMA_15G044900 [Glycine max] gb|KRH10404.1| hypothetical protein GLYMA_15G044900 [Glycine max] Length = 615 Score = 61.6 bits (148), Expect = 1e-08 Identities = 39/78 (50%), Positives = 52/78 (66%), Gaps = 5/78 (6%) Frame = -3 Query: 288 ILNNNFCSFLPLKHNFSQSLSMVE-----IENMKESYQSQAHALVNETLKQLEVAKRTVE 124 I ++ L L N ++SLS+VE + + KES +QA ALVNETL+QLE AKRTVE Sbjct: 197 IAESSDVELLNLTDNLAESLSLVENMRNQLRDSKES--AQAQALVNETLRQLEAAKRTVE 254 Query: 123 FLRAADTKKAMHGYDKCS 70 FLR AD KA++GY+ + Sbjct: 255 FLR-ADAAKAVNGYNSAA 271 >gb|KHN33445.1| Interactor of constitutive active ROPs 3 [Glycine soja] Length = 616 Score = 61.6 bits (148), Expect = 1e-08 Identities = 39/78 (50%), Positives = 52/78 (66%), Gaps = 5/78 (6%) Frame = -3 Query: 288 ILNNNFCSFLPLKHNFSQSLSMVE-----IENMKESYQSQAHALVNETLKQLEVAKRTVE 124 I ++ L L N ++SLS+VE + + KES +QA ALVNETL+QLE AKRTVE Sbjct: 198 IAESSDVELLNLTDNLAESLSLVENMRNQLRDSKES--AQAQALVNETLRQLEAAKRTVE 255 Query: 123 FLRAADTKKAMHGYDKCS 70 FLR AD KA++GY+ + Sbjct: 256 FLR-ADAAKAVNGYNSAA 272 >ref|XP_003597154.1| interactor of constitutive active ROPs-like protein [Medicago truncatula] gb|AES67405.1| interactor of constitutive active ROPs-like protein [Medicago truncatula] Length = 488 Score = 60.5 bits (145), Expect = 3e-08 Identities = 44/98 (44%), Positives = 59/98 (60%), Gaps = 13/98 (13%) Frame = -3 Query: 255 LKHNFSQSLSMV-----EIENMKESYQSQAHALVNETLKQLEVAKRTVEFLRAADTKKAM 91 L+H S+SLS+V ++ + KES +QA LVNETL+QLE AKRTVE LR AD K++ Sbjct: 101 LRHKLSKSLSLVKNMENQLRDCKES--NQAQPLVNETLRQLEAAKRTVELLR-ADAAKSV 157 Query: 90 H--------GYDKCSCYKQEGERLENGDKDNANHIETD 1 H +D+ + E ERLE D+ NHIE + Sbjct: 158 HVSKLESSLAHDR--NLEMESERLEK--NDSTNHIEIE 191 >gb|KHN05714.1| Interactor of constitutive active ROPs 3 [Glycine soja] Length = 615 Score = 57.8 bits (138), Expect = 3e-07 Identities = 39/92 (42%), Positives = 55/92 (59%), Gaps = 5/92 (5%) Frame = -3 Query: 261 LPLKHNFSQSLSMVE-----IENMKESYQSQAHALVNETLKQLEVAKRTVEFLRAADTKK 97 L LK N S++LS+V+ + + KES ++QA ALVNET QLE AK TVEFLR AD + Sbjct: 206 LNLKQNLSETLSLVDALKNQVRDCKES-EAQAQALVNETTVQLEAAKGTVEFLR-ADVAR 263 Query: 96 AMHGYDKCSCYKQEGERLENGDKDNANHIETD 1 A+ GY+ + + + N + + IE D Sbjct: 264 AVDGYNSVALELDQSKARVNSLEALVSKIEKD 295 >ref|XP_006592232.1| PREDICTED: interactor of constitutive active ROPs 3 isoform X2 [Glycine max] gb|KRH24941.1| hypothetical protein GLYMA_12G072200 [Glycine max] Length = 615 Score = 57.8 bits (138), Expect = 3e-07 Identities = 39/92 (42%), Positives = 55/92 (59%), Gaps = 5/92 (5%) Frame = -3 Query: 261 LPLKHNFSQSLSMVE-----IENMKESYQSQAHALVNETLKQLEVAKRTVEFLRAADTKK 97 L LK N S++LS+V+ + + KES ++QA ALVNET QLE AK TVEFLR AD + Sbjct: 206 LNLKQNLSETLSLVDALKNQVRDCKES-EAQAQALVNETTVQLEAAKGTVEFLR-ADVAR 263 Query: 96 AMHGYDKCSCYKQEGERLENGDKDNANHIETD 1 A+ GY+ + + + N + + IE D Sbjct: 264 AVDGYNSVALELDQSKARVNSLEALVSKIEKD 295 >ref|XP_003539735.1| PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Glycine max] ref|XP_003539736.1| PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Glycine max] ref|XP_006592228.1| PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Glycine max] ref|XP_006592229.1| PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Glycine max] ref|XP_006592230.1| PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Glycine max] ref|XP_006592231.1| PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Glycine max] ref|XP_014620044.1| PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Glycine max] gb|KRH24934.1| hypothetical protein GLYMA_12G072200 [Glycine max] gb|KRH24935.1| hypothetical protein GLYMA_12G072200 [Glycine max] gb|KRH24936.1| hypothetical protein GLYMA_12G072200 [Glycine max] gb|KRH24937.1| hypothetical protein GLYMA_12G072200 [Glycine max] gb|KRH24938.1| hypothetical protein GLYMA_12G072200 [Glycine max] gb|KRH24939.1| hypothetical protein GLYMA_12G072200 [Glycine max] gb|KRH24940.1| hypothetical protein GLYMA_12G072200 [Glycine max] Length = 615 Score = 57.8 bits (138), Expect = 3e-07 Identities = 39/92 (42%), Positives = 55/92 (59%), Gaps = 5/92 (5%) Frame = -3 Query: 261 LPLKHNFSQSLSMVE-----IENMKESYQSQAHALVNETLKQLEVAKRTVEFLRAADTKK 97 L LK N S++LS+V+ + + KES ++QA ALVNET QLE AK TVEFLR AD + Sbjct: 206 LNLKQNLSETLSLVDALKNQVRDCKES-EAQAQALVNETTVQLEAAKGTVEFLR-ADVAR 263 Query: 96 AMHGYDKCSCYKQEGERLENGDKDNANHIETD 1 A+ GY+ + + + N + + IE D Sbjct: 264 AVDGYNSVALELDQSKARVNSLEALVSKIEKD 295 >gb|PNX76294.1| Interactor of constitutive active ROPs, partial [Trifolium pratense] Length = 454 Score = 56.6 bits (135), Expect = 7e-07 Identities = 42/96 (43%), Positives = 55/96 (57%), Gaps = 13/96 (13%) Frame = -3 Query: 255 LKHNFSQSLSMV-----EIENMKESYQSQAHALVNETLKQLEVAKRTVEFLRAADTKKAM 91 LKH +SLS+V ++E+ KES Q+Q LVNETL+QLE AKR VE LR A+ K++ Sbjct: 65 LKHKLLESLSLVNNMKNQLEDRKESVQAQP--LVNETLRQLEAAKRAVELLR-ANAAKSV 121 Query: 90 H--------GYDKCSCYKQEGERLENGDKDNANHIE 7 H G+D + E +RLE D N IE Sbjct: 122 HVSKHESSLGHD--GNLEMESKRLEKSDSTNNIEIE 155 >ref|XP_015952353.1| interactor of constitutive active ROPs 3 [Arachis duranensis] ref|XP_015952354.1| interactor of constitutive active ROPs 3 [Arachis duranensis] ref|XP_015952355.1| interactor of constitutive active ROPs 3 [Arachis duranensis] ref|XP_015952356.1| interactor of constitutive active ROPs 3 [Arachis duranensis] ref|XP_015952357.1| interactor of constitutive active ROPs 3 [Arachis duranensis] Length = 602 Score = 56.6 bits (135), Expect = 7e-07 Identities = 39/89 (43%), Positives = 55/89 (61%), Gaps = 6/89 (6%) Frame = -3 Query: 261 LPLKHNFSQSLSMVE-----IENMKESYQSQAHALVNETLKQLEVAKRTVEFLRAADTKK 97 L LK N S++LS+VE + N KES ++QA A+VNETL QLE A RTV+ LR D K Sbjct: 205 LSLKQNLSETLSLVEEMKNQLRNCKES-EAQAQAMVNETLLQLEEANRTVDQLR-TDAAK 262 Query: 96 AMHGYDKCSCYKQEGE-RLENGDKDNANH 13 A+ GY+ + E R+ + ++ +NH Sbjct: 263 AVDGYNSIALELDESRARINSLEELASNH 291 >ref|XP_016187376.1| interactor of constitutive active ROPs 3 [Arachis ipaensis] ref|XP_016187377.1| interactor of constitutive active ROPs 3 [Arachis ipaensis] ref|XP_016187378.1| interactor of constitutive active ROPs 3 [Arachis ipaensis] ref|XP_020973467.1| interactor of constitutive active ROPs 3 [Arachis ipaensis] Length = 602 Score = 55.5 bits (132), Expect = 2e-06 Identities = 38/89 (42%), Positives = 55/89 (61%), Gaps = 6/89 (6%) Frame = -3 Query: 261 LPLKHNFSQSLSMVE-----IENMKESYQSQAHALVNETLKQLEVAKRTVEFLRAADTKK 97 L LK N S++LS+VE + N K+S ++QA A+VNETL QLE A RTV+ LR D K Sbjct: 205 LSLKQNLSETLSLVEEMKNQLRNCKQS-EAQAQAMVNETLLQLEEANRTVDQLR-TDAAK 262 Query: 96 AMHGYDKCSCYKQEGE-RLENGDKDNANH 13 A+ GY+ + E R+ + ++ +NH Sbjct: 263 AVDGYNSIALELDESRARINSLEELASNH 291 >gb|KHN30239.1| Interactor of constitutive active ROPs 3 [Glycine soja] Length = 391 Score = 54.3 bits (129), Expect = 4e-06 Identities = 30/47 (63%), Positives = 39/47 (82%) Frame = -3 Query: 219 EIENMKESYQSQAHALVNETLKQLEVAKRTVEFLRAADTKKAMHGYD 79 ++++ KES +QA ALVNETL+QLE AKRTVEFLR AD KA++GY+ Sbjct: 4 QLKDSKES--AQAQALVNETLRQLEAAKRTVEFLR-ADAAKAVNGYN 47