BLASTX nr result
ID: Astragalus22_contig00037011
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00037011 (386 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010549337.1| PREDICTED: squamosa promoter-binding-like pr... 86 1e-18 emb|CDY17204.1| BnaA05g09840D [Brassica napus] 83 1e-17 ref|XP_013646802.1| squamosa promoter-binding-like protein 3 [Br... 83 2e-17 ref|XP_022721038.1| squamosa promoter-binding-like protein 3 iso... 84 2e-17 ref|XP_006295226.1| squamosa promoter-binding-like protein 3 [Ca... 82 3e-17 dbj|GAU23630.1| hypothetical protein TSUD_386190 [Trifolium subt... 82 4e-17 ref|XP_017978774.1| PREDICTED: squamosa promoter-binding-like pr... 82 4e-17 gb|PNT11953.1| hypothetical protein POPTR_011G055900v3 [Populus ... 82 4e-17 ref|XP_011043410.1| PREDICTED: squamosa promoter-binding-like pr... 82 4e-17 ref|XP_009143829.1| PREDICTED: squamosa promoter-binding-like pr... 82 4e-17 ref|XP_007148144.1| hypothetical protein PHAVU_006G183900g [Phas... 81 5e-17 ref|XP_014518144.1| squamosa promoter-binding protein 1 [Vigna r... 81 5e-17 ref|XP_013752305.1| squamosa promoter-binding-like protein 3 [Br... 81 6e-17 ref|XP_013637096.1| PREDICTED: squamosa promoter-binding-like pr... 81 7e-17 gb|OMO76394.1| Transcription factor, SBP-box [Corchorus capsularis] 81 8e-17 gb|OMO65202.1| Transcription factor, SBP-box [Corchorus olitorius] 81 8e-17 gb|KYP47846.1| Squamosa promoter-binding protein 1 [Cajanus cajan] 80 1e-16 gb|PIA36592.1| hypothetical protein AQUCO_03300055v1 [Aquilegia ... 82 1e-16 ref|XP_020234618.1| squamosa promoter-binding protein 1 [Cajanus... 80 1e-16 ref|XP_003547153.1| PREDICTED: squamosa promoter-binding protein... 80 1e-16 >ref|XP_010549337.1| PREDICTED: squamosa promoter-binding-like protein 3 [Tarenaya hassleriana] Length = 166 Score = 85.9 bits (211), Expect = 1e-18 Identities = 36/41 (87%), Positives = 41/41 (100%) Frame = -3 Query: 384 RFCQQCSRFHDLGEFDEAKRSCRRRLAGHNERRRKIASEYQ 262 RFCQQCSRFH++GEFDEAKRSCRRRLAGHNERRRK+++EYQ Sbjct: 118 RFCQQCSRFHEIGEFDEAKRSCRRRLAGHNERRRKVSNEYQ 158 >emb|CDY17204.1| BnaA05g09840D [Brassica napus] Length = 142 Score = 82.8 bits (203), Expect = 1e-17 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -3 Query: 384 RFCQQCSRFHDLGEFDEAKRSCRRRLAGHNERRRKIASE 268 RFCQQCSRFHDLGEFDE+KRSCRRRLAGHNERRRK ASE Sbjct: 92 RFCQQCSRFHDLGEFDESKRSCRRRLAGHNERRRKSASE 130 >ref|XP_013646802.1| squamosa promoter-binding-like protein 3 [Brassica napus] Length = 150 Score = 82.8 bits (203), Expect = 2e-17 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -3 Query: 384 RFCQQCSRFHDLGEFDEAKRSCRRRLAGHNERRRKIASE 268 RFCQQCSRFHDLGEFDE+KRSCRRRLAGHNERRRK ASE Sbjct: 100 RFCQQCSRFHDLGEFDESKRSCRRRLAGHNERRRKSASE 138 >ref|XP_022721038.1| squamosa promoter-binding-like protein 3 isoform X1 [Durio zibethinus] Length = 184 Score = 83.6 bits (205), Expect = 2e-17 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -3 Query: 384 RFCQQCSRFHDLGEFDEAKRSCRRRLAGHNERRRKIASEYQ 262 RFCQQCSRFH+L EFDEAKRSCRRRLAGHNERRRK +SEYQ Sbjct: 138 RFCQQCSRFHELSEFDEAKRSCRRRLAGHNERRRKSSSEYQ 178 >ref|XP_006295226.1| squamosa promoter-binding-like protein 3 [Capsella rubella] gb|EOA28124.1| hypothetical protein CARUB_v10024311mg [Capsella rubella] Length = 130 Score = 81.6 bits (200), Expect = 3e-17 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 384 RFCQQCSRFHDLGEFDEAKRSCRRRLAGHNERRRKIASE 268 RFCQQCSRFH+LGEFDEAKRSCRRRLAGHNERRRK A+E Sbjct: 92 RFCQQCSRFHELGEFDEAKRSCRRRLAGHNERRRKTATE 130 >dbj|GAU23630.1| hypothetical protein TSUD_386190 [Trifolium subterraneum] Length = 141 Score = 81.6 bits (200), Expect = 4e-17 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -3 Query: 384 RFCQQCSRFHDLGEFDEAKRSCRRRLAGHNERRRKIASEYQ 262 RFCQQCSRFH+L EFD+ KRSCRRRLAGHNERRRK ASEYQ Sbjct: 97 RFCQQCSRFHELSEFDDLKRSCRRRLAGHNERRRKSASEYQ 137 >ref|XP_017978774.1| PREDICTED: squamosa promoter-binding-like protein 3 isoform X2 [Theobroma cacao] gb|EOY28200.1| Squamosa promoter binding protein-like 3 [Theobroma cacao] Length = 141 Score = 81.6 bits (200), Expect = 4e-17 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -3 Query: 384 RFCQQCSRFHDLGEFDEAKRSCRRRLAGHNERRRKIASEY 265 RFCQQCSRFH+L EFDEAKRSCRRRLAGHNERRRK +SEY Sbjct: 95 RFCQQCSRFHELSEFDEAKRSCRRRLAGHNERRRKSSSEY 134 >gb|PNT11953.1| hypothetical protein POPTR_011G055900v3 [Populus trichocarpa] Length = 144 Score = 81.6 bits (200), Expect = 4e-17 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = -3 Query: 384 RFCQQCSRFHDLGEFDEAKRSCRRRLAGHNERRRKIASEYQ 262 RFCQQCSRFHDL EFD++KRSCRRRLAGHNERRRK ++EYQ Sbjct: 99 RFCQQCSRFHDLSEFDDSKRSCRRRLAGHNERRRKSSAEYQ 139 >ref|XP_011043410.1| PREDICTED: squamosa promoter-binding-like protein 3 [Populus euphratica] Length = 144 Score = 81.6 bits (200), Expect = 4e-17 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = -3 Query: 384 RFCQQCSRFHDLGEFDEAKRSCRRRLAGHNERRRKIASEYQ 262 RFCQQCSRFHDL EFD++KRSCRRRLAGHNERRRK ++EYQ Sbjct: 99 RFCQQCSRFHDLSEFDDSKRSCRRRLAGHNERRRKSSAEYQ 139 >ref|XP_009143829.1| PREDICTED: squamosa promoter-binding-like protein 3 [Brassica rapa] Length = 150 Score = 81.6 bits (200), Expect = 4e-17 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 384 RFCQQCSRFHDLGEFDEAKRSCRRRLAGHNERRRKIASE 268 RFCQQCSRFHDLGEFDE+KRSCRRRLAGHNERRRK A+E Sbjct: 100 RFCQQCSRFHDLGEFDESKRSCRRRLAGHNERRRKSATE 138 >ref|XP_007148144.1| hypothetical protein PHAVU_006G183900g [Phaseolus vulgaris] gb|ESW20138.1| hypothetical protein PHAVU_006G183900g [Phaseolus vulgaris] Length = 138 Score = 81.3 bits (199), Expect = 5e-17 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -3 Query: 384 RFCQQCSRFHDLGEFDEAKRSCRRRLAGHNERRRKIASEY 265 RFCQQCSRFH+L EFDE+KRSCRRRLAGHNERRRK ASEY Sbjct: 97 RFCQQCSRFHELSEFDESKRSCRRRLAGHNERRRKNASEY 136 >ref|XP_014518144.1| squamosa promoter-binding protein 1 [Vigna radiata var. radiata] ref|XP_017435360.1| PREDICTED: squamosa promoter-binding protein 1-like isoform X2 [Vigna angularis] dbj|BAT87098.1| hypothetical protein VIGAN_05043900 [Vigna angularis var. angularis] Length = 139 Score = 81.3 bits (199), Expect = 5e-17 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -3 Query: 384 RFCQQCSRFHDLGEFDEAKRSCRRRLAGHNERRRKIASEY 265 RFCQQCSRFH+L EFDE+KRSCRRRLAGHNERRRK ASEY Sbjct: 98 RFCQQCSRFHELSEFDESKRSCRRRLAGHNERRRKNASEY 137 >ref|XP_013752305.1| squamosa promoter-binding-like protein 3 [Brassica napus] emb|CDY27935.1| BnaCnng05200D [Brassica napus] Length = 147 Score = 81.3 bits (199), Expect = 6e-17 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 384 RFCQQCSRFHDLGEFDEAKRSCRRRLAGHNERRRKIASE 268 RFCQQCSRFH+LGEFDE+KRSCRRRLAGHNERRRK ASE Sbjct: 94 RFCQQCSRFHELGEFDESKRSCRRRLAGHNERRRKSASE 132 >ref|XP_013637096.1| PREDICTED: squamosa promoter-binding-like protein 3 [Brassica oleracea var. oleracea] Length = 157 Score = 81.3 bits (199), Expect = 7e-17 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 384 RFCQQCSRFHDLGEFDEAKRSCRRRLAGHNERRRKIASE 268 RFCQQCSRFH+LGEFDE+KRSCRRRLAGHNERRRK ASE Sbjct: 104 RFCQQCSRFHELGEFDESKRSCRRRLAGHNERRRKSASE 142 >gb|OMO76394.1| Transcription factor, SBP-box [Corchorus capsularis] Length = 143 Score = 80.9 bits (198), Expect = 8e-17 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -3 Query: 384 RFCQQCSRFHDLGEFDEAKRSCRRRLAGHNERRRKIASEYQ 262 RFCQQCSRFH+L EFDE KRSCRRRLAGHNERRRK +S+YQ Sbjct: 96 RFCQQCSRFHELAEFDETKRSCRRRLAGHNERRRKSSSDYQ 136 >gb|OMO65202.1| Transcription factor, SBP-box [Corchorus olitorius] Length = 144 Score = 80.9 bits (198), Expect = 8e-17 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -3 Query: 384 RFCQQCSRFHDLGEFDEAKRSCRRRLAGHNERRRKIASEYQ 262 RFCQQCSRFH+L EFDE KRSCRRRLAGHNERRRK +S+YQ Sbjct: 97 RFCQQCSRFHELAEFDETKRSCRRRLAGHNERRRKSSSDYQ 137 >gb|KYP47846.1| Squamosa promoter-binding protein 1 [Cajanus cajan] Length = 127 Score = 80.1 bits (196), Expect = 1e-16 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -3 Query: 384 RFCQQCSRFHDLGEFDEAKRSCRRRLAGHNERRRKIASEY 265 RFCQQCSRFH+L EFD++KRSCRRRLAGHNERRRK ASEY Sbjct: 85 RFCQQCSRFHELSEFDDSKRSCRRRLAGHNERRRKNASEY 124 >gb|PIA36592.1| hypothetical protein AQUCO_03300055v1 [Aquilegia coerulea] Length = 191 Score = 81.6 bits (200), Expect = 1e-16 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -3 Query: 384 RFCQQCSRFHDLGEFDEAKRSCRRRLAGHNERRRKIASEYQ 262 RFCQQCSRFH+L EFDEAKRSCRRRLAGHNERRRK +SE+Q Sbjct: 111 RFCQQCSRFHELSEFDEAKRSCRRRLAGHNERRRKNSSEFQ 151 >ref|XP_020234618.1| squamosa promoter-binding protein 1 [Cajanus cajan] Length = 138 Score = 80.1 bits (196), Expect = 1e-16 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -3 Query: 384 RFCQQCSRFHDLGEFDEAKRSCRRRLAGHNERRRKIASEY 265 RFCQQCSRFH+L EFD++KRSCRRRLAGHNERRRK ASEY Sbjct: 96 RFCQQCSRFHELSEFDDSKRSCRRRLAGHNERRRKNASEY 135 >ref|XP_003547153.1| PREDICTED: squamosa promoter-binding protein 1-like [Glycine max] gb|KHN24765.1| Squamosa promoter-binding protein 1 [Glycine soja] gb|KRH10909.1| hypothetical protein GLYMA_15G076200 [Glycine max] Length = 138 Score = 80.1 bits (196), Expect = 1e-16 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -3 Query: 384 RFCQQCSRFHDLGEFDEAKRSCRRRLAGHNERRRKIASEY 265 RFCQQCSRFH+L EFD++KRSCRRRLAGHNERRRK ASEY Sbjct: 96 RFCQQCSRFHELSEFDDSKRSCRRRLAGHNERRRKNASEY 135