BLASTX nr result
ID: Astragalus22_contig00036939
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00036939 (407 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013442255.1| zinc finger A20 and AN1 domain stress-associ... 57 4e-07 dbj|BAT96407.1| hypothetical protein VIGAN_08334300 [Vigna angul... 57 4e-07 ref|XP_004513638.1| PREDICTED: zinc finger A20 and AN1 domain-co... 55 2e-06 >ref|XP_013442255.1| zinc finger A20 and AN1 domain stress-associated protein [Medicago truncatula] gb|KEH16280.1| zinc finger A20 and AN1 domain stress-associated protein [Medicago truncatula] Length = 177 Score = 56.6 bits (135), Expect = 4e-07 Identities = 26/36 (72%), Positives = 29/36 (80%), Gaps = 5/36 (13%) Frame = +3 Query: 315 MLAGGHKIMESHDET-----DRPILCINNCGFFGRA 407 MLAG HKIM+SHDET + PILC+NNCGFFGRA Sbjct: 1 MLAGDHKIMDSHDETGCQTPELPILCVNNCGFFGRA 36 >dbj|BAT96407.1| hypothetical protein VIGAN_08334300 [Vigna angularis var. angularis] Length = 180 Score = 56.6 bits (135), Expect = 4e-07 Identities = 27/36 (75%), Positives = 28/36 (77%), Gaps = 5/36 (13%) Frame = +3 Query: 315 MLAGGHKIMESHDET-----DRPILCINNCGFFGRA 407 M AG HK MESHDET +RPILCINNCGFFGRA Sbjct: 1 MFAGCHKTMESHDETGCQARERPILCINNCGFFGRA 36 >ref|XP_004513638.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 8-like [Cicer arietinum] Length = 160 Score = 54.7 bits (130), Expect = 2e-06 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +3 Query: 339 MESHDETDRPILCINNCGFFGRA 407 MESHDETDRPILC+NNCGFFGRA Sbjct: 1 MESHDETDRPILCVNNCGFFGRA 23