BLASTX nr result
ID: Astragalus22_contig00036893
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00036893 (322 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003591013.1| DUF2358 family protein [Medicago truncatula]... 57 2e-07 ref|XP_003591014.1| DUF2358 family protein [Medicago truncatula]... 57 3e-07 gb|KHN14722.1| hypothetical protein glysoja_038131 [Glycine soja] 54 9e-07 ref|XP_004495787.1| PREDICTED: uncharacterized protein LOC101494... 55 1e-06 ref|XP_004495786.1| PREDICTED: uncharacterized protein LOC101494... 55 1e-06 ref|XP_016176831.1| uncharacterized protein LOC107619122 isoform... 54 2e-06 ref|XP_015940007.1| uncharacterized protein LOC107465541 isoform... 54 3e-06 ref|XP_007144813.1| hypothetical protein PHAVU_007G186100g [Phas... 54 3e-06 ref|XP_019439954.1| PREDICTED: uncharacterized protein LOC109345... 53 6e-06 ref|XP_016176832.1| uncharacterized protein LOC107619122 isoform... 52 7e-06 dbj|GAV81182.1| DUF2358 domain-containing protein, partial [Ceph... 52 7e-06 ref|XP_019439953.1| PREDICTED: uncharacterized protein LOC109345... 53 8e-06 ref|XP_019439952.1| PREDICTED: uncharacterized protein LOC109345... 53 8e-06 gb|PNX99361.1| hypothetical protein L195_g022626, partial [Trifo... 51 1e-05 ref|XP_015940008.1| uncharacterized protein LOC107465541 isoform... 52 1e-05 >ref|XP_003591013.1| DUF2358 family protein [Medicago truncatula] gb|AES61264.1| DUF2358 family protein [Medicago truncatula] Length = 238 Score = 57.0 bits (136), Expect = 2e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 108 TGRDLYARNLKLLVPFFDCASIVLLKIEK 194 +GRDLYARNLKLLVPFFDCASI LLKIEK Sbjct: 141 SGRDLYARNLKLLVPFFDCASIKLLKIEK 169 >ref|XP_003591014.1| DUF2358 family protein [Medicago truncatula] gb|AES61265.1| DUF2358 family protein [Medicago truncatula] Length = 252 Score = 57.0 bits (136), Expect = 3e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 108 TGRDLYARNLKLLVPFFDCASIVLLKIEK 194 +GRDLYARNLKLLVPFFDCASI LLKIEK Sbjct: 141 SGRDLYARNLKLLVPFFDCASIKLLKIEK 169 >gb|KHN14722.1| hypothetical protein glysoja_038131 [Glycine soja] Length = 140 Score = 53.9 bits (128), Expect = 9e-07 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +3 Query: 108 TGRDLYARNLKLLVPFFDCASIVLLKIEK 194 TGR+LYARNLKLLVPFFDC SI+L KI+K Sbjct: 64 TGRELYARNLKLLVPFFDCGSIILQKIDK 92 >ref|XP_004495787.1| PREDICTED: uncharacterized protein LOC101494052 isoform X2 [Cicer arietinum] Length = 223 Score = 55.1 bits (131), Expect = 1e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 108 TGRDLYARNLKLLVPFFDCASIVLLKIEK 194 +GRDLYARNLKLLVPFF+CASI LLKIEK Sbjct: 124 SGRDLYARNLKLLVPFFECASIRLLKIEK 152 >ref|XP_004495786.1| PREDICTED: uncharacterized protein LOC101494052 isoform X1 [Cicer arietinum] Length = 232 Score = 55.1 bits (131), Expect = 1e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 108 TGRDLYARNLKLLVPFFDCASIVLLKIEK 194 +GRDLYARNLKLLVPFF+CASI LLKIEK Sbjct: 133 SGRDLYARNLKLLVPFFECASIRLLKIEK 161 >ref|XP_016176831.1| uncharacterized protein LOC107619122 isoform X2 [Arachis ipaensis] Length = 222 Score = 54.3 bits (129), Expect = 2e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +3 Query: 108 TGRDLYARNLKLLVPFFDCASIVLLKIEK 194 TGR+LYARNLKLLVPFFDCASI L KIEK Sbjct: 123 TGRELYARNLKLLVPFFDCASIRLQKIEK 151 >ref|XP_015940007.1| uncharacterized protein LOC107465541 isoform X2 [Arachis duranensis] Length = 223 Score = 53.9 bits (128), Expect = 3e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +3 Query: 108 TGRDLYARNLKLLVPFFDCASIVLLKIEK 194 TGR+LYARNLKLLVPFFDCASI L KIEK Sbjct: 124 TGRELYARNLKLLVPFFDCASIRLHKIEK 152 >ref|XP_007144813.1| hypothetical protein PHAVU_007G186100g [Phaseolus vulgaris] gb|ESW16807.1| hypothetical protein PHAVU_007G186100g [Phaseolus vulgaris] Length = 247 Score = 53.9 bits (128), Expect = 3e-06 Identities = 32/68 (47%), Positives = 40/68 (58%), Gaps = 3/68 (4%) Frame = +3 Query: 111 GRDLYARNLKLLVPFFDCASIVLLKIEKV---DILCKLTFYTTFLWCCICRKLYMQEASF 281 GR+LYARNLKLLVPFFD ASI+L KIEK+ ++ K T + W R++ Sbjct: 131 GRELYARNLKLLVPFFDQASIILQKIEKLHLQSLMEKTTIFVLSKWSLTWRRI------M 184 Query: 282 NLFTLQNE 305 F QNE Sbjct: 185 KSFRCQNE 192 >ref|XP_019439954.1| PREDICTED: uncharacterized protein LOC109345420 isoform X3 [Lupinus angustifolius] Length = 198 Score = 52.8 bits (125), Expect = 6e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +3 Query: 111 GRDLYARNLKLLVPFFDCASIVLLKIEK 194 GR+LYARNLKLLVPFFDCASI L KIEK Sbjct: 97 GRELYARNLKLLVPFFDCASIKLQKIEK 124 >ref|XP_016176832.1| uncharacterized protein LOC107619122 isoform X3 [Arachis ipaensis] Length = 186 Score = 52.4 bits (124), Expect = 7e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +3 Query: 111 GRDLYARNLKLLVPFFDCASIVLLKIEK 194 GR+LYARNLKLLVPFFDCASI L KIEK Sbjct: 146 GRELYARNLKLLVPFFDCASIRLQKIEK 173 >dbj|GAV81182.1| DUF2358 domain-containing protein, partial [Cephalotus follicularis] Length = 191 Score = 52.4 bits (124), Expect = 7e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = +3 Query: 108 TGRDLYARNLKLLVPFFDCASIVLLKIEK 194 TGR+LY+RNLKLLVPFFDC SI L KIEK Sbjct: 97 TGRELYSRNLKLLVPFFDCPSIALQKIEK 125 >ref|XP_019439953.1| PREDICTED: uncharacterized protein LOC109345420 isoform X2 [Lupinus angustifolius] gb|OIW13825.1| hypothetical protein TanjilG_31714 [Lupinus angustifolius] Length = 238 Score = 52.8 bits (125), Expect = 8e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +3 Query: 111 GRDLYARNLKLLVPFFDCASIVLLKIEK 194 GR+LYARNLKLLVPFFDCASI L KIEK Sbjct: 137 GRELYARNLKLLVPFFDCASIKLQKIEK 164 >ref|XP_019439952.1| PREDICTED: uncharacterized protein LOC109345420 isoform X1 [Lupinus angustifolius] Length = 240 Score = 52.8 bits (125), Expect = 8e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +3 Query: 111 GRDLYARNLKLLVPFFDCASIVLLKIEK 194 GR+LYARNLKLLVPFFDCASI L KIEK Sbjct: 139 GRELYARNLKLLVPFFDCASIKLQKIEK 166 >gb|PNX99361.1| hypothetical protein L195_g022626, partial [Trifolium pratense] Length = 119 Score = 50.8 bits (120), Expect = 1e-05 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = +3 Query: 108 TGRDLYARNLKLLVPFFDCASIVLLKIEK 194 +G +LY RNLKLLVPFFDCASI LLKIEK Sbjct: 22 SGTELYERNLKLLVPFFDCASIRLLKIEK 50 >ref|XP_015940008.1| uncharacterized protein LOC107465541 isoform X3 [Arachis duranensis] Length = 187 Score = 52.0 bits (123), Expect = 1e-05 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +3 Query: 111 GRDLYARNLKLLVPFFDCASIVLLKIEK 194 GR+LYARNLKLLVPFFDCASI L KIEK Sbjct: 147 GRELYARNLKLLVPFFDCASIRLHKIEK 174