BLASTX nr result
ID: Astragalus22_contig00036758
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00036758 (374 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU13045.1| hypothetical protein TSUD_173450 [Trifolium subt... 43 1e-09 dbj|GAU13047.1| hypothetical protein TSUD_173470 [Trifolium subt... 43 2e-08 ref|XP_013467007.1| cyclin-like F-box protein [Medicago truncatu... 52 3e-08 ref|XP_013448143.1| cyclin-like F-box protein [Medicago truncatu... 44 2e-07 ref|XP_013448168.1| F-box/RNI/FBD-like domain protein [Medicago ... 44 2e-06 >dbj|GAU13045.1| hypothetical protein TSUD_173450 [Trifolium subterraneum] Length = 343 Score = 43.1 bits (100), Expect(3) = 1e-09 Identities = 20/45 (44%), Positives = 27/45 (60%), Gaps = 6/45 (13%) Frame = +1 Query: 256 NAKFLLAELRTTYDYRLPRFHNLTHMELIF------NSDSWDGKW 372 NAKFL A+L Y ++P FHNLTH++++F W GKW Sbjct: 232 NAKFLCAKLYRPYGCQVPVFHNLTHLKIVFAWTKIDGLGKWIGKW 276 Score = 42.4 bits (98), Expect(3) = 1e-09 Identities = 25/66 (37%), Positives = 35/66 (53%), Gaps = 1/66 (1%) Frame = +3 Query: 51 IEFFLSDFAHFRNFVQGCPILEYLYINYVALPEMCHDLEGEFQGFPKLVRANLGYSEE-N 227 I F D + F+ GCP+LE L + + L C+ GEF G KLV+AN+ + Sbjct: 168 INFSELDPRFLKTFLHGCPVLEDLDLQDILL---CNRKCGEFNGLLKLVKANINIKKGWI 224 Query: 228 FPFDWV 245 FPF W+ Sbjct: 225 FPFAWI 230 Score = 24.3 bits (51), Expect(3) = 1e-09 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +2 Query: 14 LVYLPLLKTLHLDRI 58 +V LPLLKTLH + I Sbjct: 154 IVNLPLLKTLHFENI 168 >dbj|GAU13047.1| hypothetical protein TSUD_173470 [Trifolium subterraneum] Length = 387 Score = 43.1 bits (100), Expect(3) = 2e-08 Identities = 18/41 (43%), Positives = 27/41 (65%), Gaps = 2/41 (4%) Frame = +1 Query: 256 NAKFLLAELRTTYDYRLPRFHNLTHMELIF--NSDSWDGKW 372 NAKFL A L Y +++P FHNLT ++++F ++ W KW Sbjct: 230 NAKFLCANLYRPYGFQVPAFHNLTQLKIVFGGTTNDWPVKW 270 Score = 40.0 bits (92), Expect(3) = 2e-08 Identities = 22/58 (37%), Positives = 31/58 (53%) Frame = +3 Query: 84 RNFVQGCPILEYLYINYVALPEMCHDLEGEFQGFPKLVRANLGYSEENFPFDWVHKSQ 257 + + GCP+LE L + + L H GEF G KLV+AN+ FPF WV ++ Sbjct: 178 KRILHGCPVLEDLQLQDMLLSN--HKC-GEFNGLLKLVKANINIKGWVFPFAWVRNAK 232 Score = 21.9 bits (45), Expect(3) = 2e-08 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +2 Query: 17 VYLPLLKTLHLDRI 58 V PLLKTLH + I Sbjct: 153 VNFPLLKTLHFENI 166 >ref|XP_013467007.1| cyclin-like F-box protein [Medicago truncatula] gb|KEH41042.1| cyclin-like F-box protein [Medicago truncatula] Length = 386 Score = 51.6 bits (122), Expect(3) = 3e-08 Identities = 23/40 (57%), Positives = 29/40 (72%), Gaps = 1/40 (2%) Frame = +1 Query: 256 NAKFLLAELR-TTYDYRLPRFHNLTHMELIFNSDSWDGKW 372 NAKFL A+L YDY++P F NLTHME+ F++ W GKW Sbjct: 233 NAKFLRAKLNYPNYDYQVPTFPNLTHMEIAFDTYEWPGKW 272 Score = 30.0 bits (66), Expect(3) = 3e-08 Identities = 20/53 (37%), Positives = 25/53 (47%) Frame = +3 Query: 99 GCPILEYLYINYVALPEMCHDLEGEFQGFPKLVRANLGYSEENFPFDWVHKSQ 257 GCPILE L N +F G KLVRAN+ + PFD V ++ Sbjct: 184 GCPILEELQTNGFLFRRKLK-AGRDFNGLHKLVRANIMNLGCSVPFDLVRNAK 235 Score = 23.1 bits (48), Expect(3) = 3e-08 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +2 Query: 17 VYLPLLKTLHLDRI 58 V PLLKTLHL+ I Sbjct: 155 VNFPLLKTLHLEAI 168 >ref|XP_013448143.1| cyclin-like F-box protein [Medicago truncatula] gb|KEH22170.1| cyclin-like F-box protein [Medicago truncatula] Length = 365 Score = 44.3 bits (103), Expect(2) = 2e-07 Identities = 23/39 (58%), Positives = 29/39 (74%) Frame = +1 Query: 256 NAKFLLAELRTTYDYRLPRFHNLTHMELIFNSDSWDGKW 372 NAKFL ELR + ++++ FHNLTHMELIF S +W KW Sbjct: 219 NAKFLRLELRHS-EHQVHAFHNLTHMELIFTS-NWRTKW 255 Score = 38.5 bits (88), Expect(2) = 2e-07 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = +3 Query: 81 FRNFVQGCPILEYLYINYVALPEMCHDLEGEFQGFPKLVRANLG-YSEENFPFDWV 245 F ++GCPILE L I + L D GEF+ P LVRAN+ + ++ F W+ Sbjct: 163 FNKLIEGCPILEELEIPSL-LCRFSKDGIGEFKHLPNLVRANISKFVPKSIQFAWI 217 >ref|XP_013448168.1| F-box/RNI/FBD-like domain protein [Medicago truncatula] gb|KEH22195.1| F-box/RNI/FBD-like domain protein [Medicago truncatula] Length = 310 Score = 44.3 bits (103), Expect(2) = 2e-06 Identities = 30/80 (37%), Positives = 38/80 (47%), Gaps = 4/80 (5%) Frame = +3 Query: 18 FIFPYSKPS--TWIEFFLSDFAHFRNFVQGCPILEYLYINYVA--LPEMCHDLEGEFQGF 185 F FP K ++ FF + F GCPILE L I+ V L C GEF+G Sbjct: 88 FDFPLLKTLHLAYVYFFGDHTSDFNKLFVGCPILEDLQISNVQFLLSNRCDG--GEFKGL 145 Query: 186 PKLVRANLGYSEENFPFDWV 245 LVRA++ N PF W+ Sbjct: 146 SNLVRADISNRCWNMPFSWI 165 Score = 35.0 bits (79), Expect(2) = 2e-06 Identities = 21/39 (53%), Positives = 25/39 (64%) Frame = +1 Query: 256 NAKFLLAELRTTYDYRLPRFHNLTHMELIFNSDSWDGKW 372 NAKFL L + + ++ FHNLT MELIF S SW KW Sbjct: 167 NAKFLRVIL--SKEQQVHNFHNLTCMELIFGS-SWCTKW 202