BLASTX nr result
ID: Astragalus22_contig00036744
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00036744 (307 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004492508.1| PREDICTED: pentatricopeptide repeat-containi... 87 7e-18 dbj|GAU18422.1| hypothetical protein TSUD_203100 [Trifolium subt... 86 1e-17 dbj|GAU18421.1| hypothetical protein TSUD_203110 [Trifolium subt... 86 2e-17 ref|XP_003623405.1| PPR containing plant-like protein [Medicago ... 80 4e-15 gb|PNX55857.1| hypothetical protein L195_g049490, partial [Trifo... 77 1e-14 gb|PNX72947.1| pentatricopeptide repeat-containing protein, part... 76 3e-14 ref|XP_019423092.1| PREDICTED: pentatricopeptide repeat-containi... 66 3e-10 dbj|GAU17155.1| hypothetical protein TSUD_177850 [Trifolium subt... 61 8e-09 gb|KHN40689.1| Pentatricopeptide repeat-containing protein [Glyc... 57 2e-07 ref|XP_014625770.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-07 gb|KYP63608.1| Pentatricopeptide repeat-containing protein At3g1... 57 5e-07 ref|XP_020219048.1| pentatricopeptide repeat-containing protein ... 57 5e-07 >ref|XP_004492508.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18020 [Cicer arietinum] Length = 667 Score = 87.4 bits (215), Expect = 7e-18 Identities = 42/61 (68%), Positives = 48/61 (78%) Frame = +1 Query: 1 PDCVTWRILHKLHGKVRKHTPSEDPTLSTIYEDEEMVNEASHDRRKWNLVSTSSGRPLDF 180 PDCVTWRIL+KL KVRKH+ SEDP TIYE ++M N+A D RKWN V TSSG+PLDF Sbjct: 609 PDCVTWRILYKLQSKVRKHSKSEDP---TIYEGDDMDNKAIQDIRKWNSVFTSSGKPLDF 665 Query: 181 T 183 T Sbjct: 666 T 666 >dbj|GAU18422.1| hypothetical protein TSUD_203100 [Trifolium subterraneum] Length = 427 Score = 86.3 bits (212), Expect = 1e-17 Identities = 41/62 (66%), Positives = 48/62 (77%), Gaps = 1/62 (1%) Frame = +1 Query: 1 PDCVTWRILHKLHGKVRKHTPSEDPTLSTIYEDEEMVNEASHDRRKWNLVSTSS-GRPLD 177 PDCVTWR+LHKL VRKHTPSED TLST+ E +M ++AS DRRKW TS+ G+PLD Sbjct: 365 PDCVTWRVLHKLQSNVRKHTPSEDLTLSTVDESVDMDDKASQDRRKWISACTSNGGKPLD 424 Query: 178 FT 183 FT Sbjct: 425 FT 426 >dbj|GAU18421.1| hypothetical protein TSUD_203110 [Trifolium subterraneum] Length = 922 Score = 86.3 bits (212), Expect = 2e-17 Identities = 41/62 (66%), Positives = 48/62 (77%), Gaps = 1/62 (1%) Frame = +1 Query: 1 PDCVTWRILHKLHGKVRKHTPSEDPTLSTIYEDEEMVNEASHDRRKWNLVSTSS-GRPLD 177 PDCVTWR+LHKL VRKHTPSED TLST+ E +M ++AS DRRKW TS+ G+PLD Sbjct: 860 PDCVTWRVLHKLQSNVRKHTPSEDLTLSTVDESVDMDDKASQDRRKWISACTSNGGKPLD 919 Query: 178 FT 183 FT Sbjct: 920 FT 921 >ref|XP_003623405.1| PPR containing plant-like protein [Medicago truncatula] gb|AES79623.1| PPR containing plant-like protein [Medicago truncatula] Length = 737 Score = 79.7 bits (195), Expect = 4e-15 Identities = 39/54 (72%), Positives = 42/54 (77%) Frame = +1 Query: 1 PDCVTWRILHKLHGKVRKHTPSEDPTLSTIYEDEEMVNEASHDRRKWNLVSTSS 162 PDCVTWRILHKL KV KHTP EDPTLST E +M N+AS +RRKWN V TSS Sbjct: 605 PDCVTWRILHKLQSKVTKHTPFEDPTLST--EGVDMDNKASQNRRKWNYVCTSS 656 >gb|PNX55857.1| hypothetical protein L195_g049490, partial [Trifolium pratense] Length = 265 Score = 76.6 bits (187), Expect = 1e-14 Identities = 36/55 (65%), Positives = 41/55 (74%) Frame = +1 Query: 1 PDCVTWRILHKLHGKVRKHTPSEDPTLSTIYEDEEMVNEASHDRRKWNLVSTSSG 165 PDCVTWR+LHKL VRK TPSED TLST+ E +M ++AS DRRKW TSSG Sbjct: 184 PDCVTWRVLHKLQSNVRKXTPSEDLTLSTVDEGVDMDDKASRDRRKWISACTSSG 238 >gb|PNX72947.1| pentatricopeptide repeat-containing protein, partial [Trifolium pratense] Length = 286 Score = 75.9 bits (185), Expect = 3e-14 Identities = 35/55 (63%), Positives = 41/55 (74%) Frame = +1 Query: 1 PDCVTWRILHKLHGKVRKHTPSEDPTLSTIYEDEEMVNEASHDRRKWNLVSTSSG 165 PDCVTWR+LHKL VRKHT SE TLST+ E ++M ++AS DRRKW TSSG Sbjct: 184 PDCVTWRVLHKLQSNVRKHTSSEHLTLSTVDEGDDMDDKASQDRRKWISACTSSG 238 >ref|XP_019423092.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18020 [Lupinus angustifolius] gb|OIW17503.1| hypothetical protein TanjilG_22615 [Lupinus angustifolius] Length = 653 Score = 65.9 bits (159), Expect = 3e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 1 PDCVTWRILHKLHGKVRKHTPSEDPTLSTIYE 96 PDCVTWRIL+KLHGKVRKH SEDPTLSTIYE Sbjct: 621 PDCVTWRILNKLHGKVRKHPGSEDPTLSTIYE 652 >dbj|GAU17155.1| hypothetical protein TSUD_177850 [Trifolium subterraneum] Length = 240 Score = 60.8 bits (146), Expect = 8e-09 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = +1 Query: 1 PDCVTWRILHKLHGKVRKHTPSEDPTLSTIYEDEEMVNEASHDRR 135 PDCVTWR+LHKL VRKHT SED TLST+ E ++MV +R+ Sbjct: 177 PDCVTWRVLHKLQSNVRKHTSSEDLTLSTVDEGDDMVGIELKERK 221 >gb|KHN40689.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 525 Score = 57.4 bits (137), Expect = 2e-07 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = +1 Query: 1 PDCVTWRILHKLHGKVRKHTPSEDPTLSTIYEDEEM 108 PD VTWRIL KLHGKVRK SEDPT+ST YE +M Sbjct: 489 PDSVTWRILDKLHGKVRKDIHSEDPTMSTTYEGHDM 524 >ref|XP_014625770.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18020 [Glycine max] gb|KRH00347.1| hypothetical protein GLYMA_18G207800 [Glycine max] Length = 650 Score = 57.4 bits (137), Expect = 2e-07 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = +1 Query: 1 PDCVTWRILHKLHGKVRKHTPSEDPTLSTIYEDEEM 108 PD VTWRIL KLHGKVRK SEDPT+ST YE +M Sbjct: 614 PDSVTWRILDKLHGKVRKDIHSEDPTMSTTYEGHDM 649 >gb|KYP63608.1| Pentatricopeptide repeat-containing protein At3g18020 family [Cajanus cajan] Length = 503 Score = 56.6 bits (135), Expect = 5e-07 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +1 Query: 1 PDCVTWRILHKLHGKVRKHTPSEDPTLSTIYEDEEM 108 PD VTWRIL KLHGKVRK+ SED T+STIYE +M Sbjct: 454 PDSVTWRILDKLHGKVRKNIHSEDSTMSTIYEGPDM 489 >ref|XP_020219048.1| pentatricopeptide repeat-containing protein At3g18020 [Cajanus cajan] Length = 650 Score = 56.6 bits (135), Expect = 5e-07 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +1 Query: 1 PDCVTWRILHKLHGKVRKHTPSEDPTLSTIYEDEEM 108 PD VTWRIL KLHGKVRK+ SED T+STIYE +M Sbjct: 601 PDSVTWRILDKLHGKVRKNIHSEDSTMSTIYEGPDM 636