BLASTX nr result
ID: Astragalus22_contig00036626
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00036626 (656 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013452568.1| animal RPA1 domain protein [Medicago truncat... 43 9e-06 >ref|XP_013452568.1| animal RPA1 domain protein [Medicago truncatula] gb|KEH26596.1| animal RPA1 domain protein [Medicago truncatula] Length = 172 Score = 43.1 bits (100), Expect(2) = 9e-06 Identities = 18/45 (40%), Positives = 27/45 (60%) Frame = +3 Query: 135 YLISTK*H*VQNTSHKYKLNFMRTTRVTNISAEDTPLYHFDFSEF 269 +++ + H + T HKYKLNFM T V +S+ + P +HF F F Sbjct: 77 FMVGSNDHAYKTTGHKYKLNFMGGTNVFRVSSVNIPAHHFTFMPF 121 Score = 34.7 bits (78), Expect(2) = 9e-06 Identities = 17/39 (43%), Positives = 22/39 (56%) Frame = +2 Query: 377 FIFSHYFSNDSQYRYT*FTDAIGHVVQKDTLKEKEKDGR 493 F F + S R D IGHVV+KD +KE EK+G+ Sbjct: 116 FTFMPFMQIVSATREDKLLDVIGHVVEKDVIKETEKNGK 154