BLASTX nr result
ID: Astragalus22_contig00036598
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00036598 (350 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020222135.1| uncharacterized protein LOC109804718 isoform... 51 9e-06 >ref|XP_020222135.1| uncharacterized protein LOC109804718 isoform X2 [Cajanus cajan] Length = 120 Score = 51.2 bits (121), Expect = 9e-06 Identities = 20/48 (41%), Positives = 28/48 (58%) Frame = +1 Query: 205 AWELQDQLFXXXXXXXXXXXXXXXVIGCHHTWKLWERIHHNIHLQIKS 348 AWELQDQL VIGC ++W+LWE++HH+ H + K+ Sbjct: 64 AWELQDQLLLAWLQSSLSSSILLKVIGCRYSWQLWEKVHHHFHSKTKA 111