BLASTX nr result
ID: Astragalus22_contig00035948
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00035948 (329 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022640915.1| serine--tRNA ligase isoform X1 [Vigna radiat... 64 1e-09 ref|XP_019452251.1| PREDICTED: serine--tRNA ligase-like isoform ... 64 2e-09 >ref|XP_022640915.1| serine--tRNA ligase isoform X1 [Vigna radiata var. radiata] Length = 483 Score = 64.3 bits (155), Expect = 1e-09 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = -2 Query: 301 KHVEFNRAAHILSSITKFIGKRNAVWKIGTRIFNVSL 191 KHV+FNRAAHIL+S T F+GKRNAVWK+G R+FN+ L Sbjct: 447 KHVQFNRAAHILNSFTNFVGKRNAVWKMGARVFNLVL 483 >ref|XP_019452251.1| PREDICTED: serine--tRNA ligase-like isoform X1 [Lupinus angustifolius] Length = 481 Score = 63.9 bits (154), Expect = 2e-09 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -2 Query: 322 KKSKAAVKHVEFNRAAHILSSITKFIGKRNAVWKIGTRIFN 200 K+ + A+KHV+ NRA HIL+SITKFIGK+NA WK GTRIF+ Sbjct: 438 KEPRGALKHVQVNRAHHILNSITKFIGKKNAAWKFGTRIFS 478