BLASTX nr result
ID: Astragalus22_contig00035900
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00035900 (572 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003618414.1| inositol polyphosphate 5-phosphatase I [Medi... 69 4e-10 ref|XP_004489353.1| PREDICTED: type I inositol 1,4,5-trisphospha... 66 3e-09 gb|OMO52763.1| Inositol polyphosphate-related phosphatase [Corch... 63 3e-08 gb|OMO79096.1| Inositol polyphosphate-related phosphatase [Corch... 63 3e-08 gb|KYP53095.1| Type I inositol-1,4,5-trisphosphate 5-phosphatase... 60 4e-08 ref|XP_003543840.1| PREDICTED: type IV inositol polyphosphate 5-... 63 4e-08 ref|XP_003554865.1| PREDICTED: type I inositol polyphosphate 5-p... 63 4e-08 ref|XP_014506215.1| type I inositol polyphosphate 5-phosphatase ... 63 4e-08 ref|XP_017407168.1| PREDICTED: type I inositol polyphosphate 5-p... 63 4e-08 gb|PIN03046.1| Inositol-polyphosphate 5-phosphatase [Handroanthu... 60 7e-08 gb|OAY25755.1| hypothetical protein MANES_17G117400 [Manihot esc... 61 2e-07 ref|XP_021599802.1| type I inositol polyphosphate 5-phosphatase ... 61 2e-07 ref|XP_021599801.1| type I inositol polyphosphate 5-phosphatase ... 61 2e-07 ref|XP_021599800.1| type IV inositol polyphosphate 5-phosphatase... 61 2e-07 ref|XP_012082502.1| type IV inositol polyphosphate 5-phosphatase... 61 2e-07 dbj|GAY46378.1| hypothetical protein CUMW_096560 [Citrus unshiu] 60 2e-07 gb|KDO72408.1| hypothetical protein CISIN_1g011549mg [Citrus sin... 60 2e-07 ref|XP_006482505.1| PREDICTED: type IV inositol polyphosphate 5-... 60 2e-07 ref|XP_006431033.1| type IV inositol polyphosphate 5-phosphatase... 60 2e-07 ref|XP_021654771.1| type IV inositol polyphosphate 5-phosphatase... 60 3e-07 >ref|XP_003618414.1| inositol polyphosphate 5-phosphatase I [Medicago truncatula] gb|AES74632.1| inositol polyphosphate 5-phosphatase I [Medicago truncatula] Length = 447 Score = 68.6 bits (166), Expect = 4e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +3 Query: 474 LCNSRIFWFGDLNYRLYLKDHLARHIIRKQDWK 572 L + RIFWFGDLNYRLYLKDHLARH+IRKQDWK Sbjct: 270 LGHDRIFWFGDLNYRLYLKDHLARHLIRKQDWK 302 >ref|XP_004489353.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase CVP2-like [Cicer arietinum] Length = 450 Score = 65.9 bits (159), Expect = 3e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +3 Query: 474 LCNSRIFWFGDLNYRLYLKDHLARHIIRKQDWK 572 L + RIFWFGDLNYRLYLKD+LARH+IRKQDWK Sbjct: 275 LGHDRIFWFGDLNYRLYLKDNLARHLIRKQDWK 307 >gb|OMO52763.1| Inositol polyphosphate-related phosphatase [Corchorus olitorius] Length = 447 Score = 63.2 bits (152), Expect = 3e-08 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +3 Query: 474 LCNSRIFWFGDLNYRLYLKDHLARHIIRKQDWK 572 L + RIFWFGDLNYRLYL+D+LARH+I+KQDWK Sbjct: 265 LGHDRIFWFGDLNYRLYLEDNLARHLIKKQDWK 297 >gb|OMO79096.1| Inositol polyphosphate-related phosphatase [Corchorus capsularis] Length = 496 Score = 63.2 bits (152), Expect = 3e-08 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +3 Query: 474 LCNSRIFWFGDLNYRLYLKDHLARHIIRKQDWK 572 L + RIFWFGDLNYRLYL+D+LARH+I+KQDWK Sbjct: 313 LGHDRIFWFGDLNYRLYLEDNLARHLIKKQDWK 345 >gb|KYP53095.1| Type I inositol-1,4,5-trisphosphate 5-phosphatase CVP2 [Cajanus cajan] Length = 160 Score = 60.5 bits (145), Expect = 4e-08 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +3 Query: 480 NSRIFWFGDLNYRLYLKDHLARHIIRKQDWK 572 ++RIFWFGDLNYRLY +D+ ARH+IRKQDWK Sbjct: 2 SNRIFWFGDLNYRLYSEDNFARHLIRKQDWK 32 >ref|XP_003543840.1| PREDICTED: type IV inositol polyphosphate 5-phosphatase 6-like [Glycine max] gb|KHN13263.1| Type I inositol-1,4,5-trisphosphate 5-phosphatase CVP2 [Glycine soja] gb|KRH18550.1| hypothetical protein GLYMA_13G067500 [Glycine max] Length = 463 Score = 62.8 bits (151), Expect = 4e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 474 LCNSRIFWFGDLNYRLYLKDHLARHIIRKQDWK 572 L + RIFWFGDLNYRLYL+D+ ARH+IRKQDWK Sbjct: 287 LGHDRIFWFGDLNYRLYLEDNFARHLIRKQDWK 319 >ref|XP_003554865.1| PREDICTED: type I inositol polyphosphate 5-phosphatase 2-like [Glycine max] gb|KRG93446.1| hypothetical protein GLYMA_19G016800 [Glycine max] Length = 467 Score = 62.8 bits (151), Expect = 4e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 474 LCNSRIFWFGDLNYRLYLKDHLARHIIRKQDWK 572 L + RIFWFGDLNYRLYL+D+ ARH+IRKQDWK Sbjct: 291 LGHDRIFWFGDLNYRLYLEDNFARHLIRKQDWK 323 >ref|XP_014506215.1| type I inositol polyphosphate 5-phosphatase 4 [Vigna radiata var. radiata] Length = 472 Score = 62.8 bits (151), Expect = 4e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 474 LCNSRIFWFGDLNYRLYLKDHLARHIIRKQDWK 572 L + RIFWFGDLNYRLYL+D+ ARH+IRKQDWK Sbjct: 288 LGHDRIFWFGDLNYRLYLEDNFARHLIRKQDWK 320 >ref|XP_017407168.1| PREDICTED: type I inositol polyphosphate 5-phosphatase 4-like [Vigna angularis] gb|KOM27059.1| hypothetical protein LR48_Vigan393s000300 [Vigna angularis] dbj|BAU01126.1| hypothetical protein VIGAN_11028800 [Vigna angularis var. angularis] Length = 472 Score = 62.8 bits (151), Expect = 4e-08 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 474 LCNSRIFWFGDLNYRLYLKDHLARHIIRKQDWK 572 L + RIFWFGDLNYRLYL+D+ ARH+IRKQDWK Sbjct: 288 LGHDRIFWFGDLNYRLYLEDNFARHLIRKQDWK 320 >gb|PIN03046.1| Inositol-polyphosphate 5-phosphatase [Handroanthus impetiginosus] Length = 176 Score = 60.1 bits (144), Expect = 7e-08 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +3 Query: 474 LCNSRIFWFGDLNYRLYLKDHLARHIIRKQDW 569 + NSRIFWFGDLNYRLYL+D+LAR +I++QDW Sbjct: 1 MSNSRIFWFGDLNYRLYLEDNLARQLIKEQDW 32 >gb|OAY25755.1| hypothetical protein MANES_17G117400 [Manihot esculenta] Length = 388 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = +3 Query: 474 LCNSRIFWFGDLNYRLYLKDHLARHIIRKQDWK 572 L + RIFWFGDLNYRLYL+D+LAR++I+KQDWK Sbjct: 298 LGHDRIFWFGDLNYRLYLEDNLARYLIKKQDWK 330 >ref|XP_021599802.1| type I inositol polyphosphate 5-phosphatase 4-like isoform X3 [Manihot esculenta] Length = 394 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = +3 Query: 474 LCNSRIFWFGDLNYRLYLKDHLARHIIRKQDWK 572 L + RIFWFGDLNYRLYL+D+LAR++I+KQDWK Sbjct: 304 LGHDRIFWFGDLNYRLYLEDNLARYLIKKQDWK 336 >ref|XP_021599801.1| type I inositol polyphosphate 5-phosphatase 4-like isoform X2 [Manihot esculenta] gb|OAY25756.1| hypothetical protein MANES_17G117400 [Manihot esculenta] Length = 482 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = +3 Query: 474 LCNSRIFWFGDLNYRLYLKDHLARHIIRKQDWK 572 L + RIFWFGDLNYRLYL+D+LAR++I+KQDWK Sbjct: 298 LGHDRIFWFGDLNYRLYLEDNLARYLIKKQDWK 330 >ref|XP_021599800.1| type IV inositol polyphosphate 5-phosphatase 7-like isoform X1 [Manihot esculenta] Length = 488 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = +3 Query: 474 LCNSRIFWFGDLNYRLYLKDHLARHIIRKQDWK 572 L + RIFWFGDLNYRLYL+D+LAR++I+KQDWK Sbjct: 304 LGHDRIFWFGDLNYRLYLEDNLARYLIKKQDWK 336 >ref|XP_012082502.1| type IV inositol polyphosphate 5-phosphatase 7 [Jatropha curcas] gb|KDP45431.1| hypothetical protein JCGZ_09680 [Jatropha curcas] Length = 492 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = +3 Query: 474 LCNSRIFWFGDLNYRLYLKDHLARHIIRKQDWK 572 L + RIFWFGDLNYRLYL+D+LAR++I+KQDWK Sbjct: 303 LGHDRIFWFGDLNYRLYLEDNLARYLIKKQDWK 335 >dbj|GAY46378.1| hypothetical protein CUMW_096560 [Citrus unshiu] Length = 483 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = +3 Query: 474 LCNSRIFWFGDLNYRLYLKDHLARHIIRKQDWK 572 L + +IFWFGDLNYRLYL+D+LARH+I+KQDW+ Sbjct: 298 LGHDQIFWFGDLNYRLYLEDNLARHLIKKQDWR 330 >gb|KDO72408.1| hypothetical protein CISIN_1g011549mg [Citrus sinensis] Length = 483 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = +3 Query: 474 LCNSRIFWFGDLNYRLYLKDHLARHIIRKQDWK 572 L + +IFWFGDLNYRLYL+D+LARH+I+KQDW+ Sbjct: 298 LGHDQIFWFGDLNYRLYLEDNLARHLIKKQDWR 330 >ref|XP_006482505.1| PREDICTED: type IV inositol polyphosphate 5-phosphatase 7-like [Citrus sinensis] Length = 483 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = +3 Query: 474 LCNSRIFWFGDLNYRLYLKDHLARHIIRKQDWK 572 L + +IFWFGDLNYRLYL+D+LARH+I+KQDW+ Sbjct: 298 LGHDQIFWFGDLNYRLYLEDNLARHLIKKQDWR 330 >ref|XP_006431033.1| type IV inositol polyphosphate 5-phosphatase 7 [Citrus clementina] gb|ESR44273.1| hypothetical protein CICLE_v10011612mg [Citrus clementina] Length = 483 Score = 60.5 bits (145), Expect = 2e-07 Identities = 24/33 (72%), Positives = 31/33 (93%) Frame = +3 Query: 474 LCNSRIFWFGDLNYRLYLKDHLARHIIRKQDWK 572 L + +IFWFGDLNYRLYL+D+LARH+I+KQDW+ Sbjct: 298 LGHDQIFWFGDLNYRLYLEDNLARHLIKKQDWR 330 >ref|XP_021654771.1| type IV inositol polyphosphate 5-phosphatase 6-like isoform X3 [Hevea brasiliensis] Length = 388 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +3 Query: 474 LCNSRIFWFGDLNYRLYLKDHLARHIIRKQDWK 572 L + RIFWFGDLNYRLYL+D+LAR++I KQDWK Sbjct: 298 LGHDRIFWFGDLNYRLYLEDNLARYLINKQDWK 330