BLASTX nr result
ID: Astragalus22_contig00035777
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00035777 (330 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KYP48295.1| Retrovirus-related Pol polyprotein from transposo... 54 2e-14 gb|KYP58743.1| Transposon Ty3-I Gag-Pol polyprotein [Cajanus cajan] 52 3e-14 gb|KYP53505.1| Retrovirus-related Pol polyprotein from transposo... 54 3e-14 gb|KYP40860.1| Transposon Ty3-I Gag-Pol polyprotein [Cajanus cajan] 52 3e-14 dbj|GAU50921.1| hypothetical protein TSUD_411180 [Trifolium subt... 54 3e-14 gb|KYP40284.1| Retrovirus-related Pol polyprotein from transposo... 52 4e-14 ref|XP_020211520.1| uncharacterized protein LOC109796248 [Cajanu... 54 5e-14 gb|KYP42541.1| Retrovirus-related Pol polyprotein from transposo... 52 5e-14 gb|KYP69675.1| Retrovirus-related Pol polyprotein from transposo... 54 5e-14 ref|XP_020229720.1| uncharacterized protein LOC109810620 [Cajanu... 52 6e-14 gb|KYP73371.1| Retrovirus-related Pol polyprotein from transposo... 52 6e-14 ref|XP_020208702.1| uncharacterized protein LOC109793653 [Cajanu... 52 8e-14 dbj|GAU47361.1| hypothetical protein TSUD_403640 [Trifolium subt... 54 8e-14 gb|KYP31840.1| Retrovirus-related Pol polyprotein from transposo... 52 8e-14 gb|KYP44698.1| Retrovirus-related Pol polyprotein from transposo... 52 2e-13 gb|KYP74121.1| Retrovirus-related Pol polyprotein from transposo... 54 2e-13 gb|KYP66897.1| Transposon Ty3-I Gag-Pol polyprotein [Cajanus cajan] 52 2e-13 gb|KYP49510.1| Transposon Ty3-I Gag-Pol polyprotein [Cajanus cajan] 52 2e-13 gb|KYP63265.1| Retrovirus-related Pol polyprotein from transposo... 52 4e-13 gb|KYP63264.1| Retrovirus-related Pol polyprotein from transposo... 52 4e-13 >gb|KYP48295.1| Retrovirus-related Pol polyprotein from transposon opus, partial [Cajanus cajan] Length = 408 Score = 53.5 bits (127), Expect(3) = 2e-14 Identities = 20/27 (74%), Positives = 24/27 (88%) Frame = +1 Query: 118 IR*KNGKWRLCVDYTNLNKACPKEAFP 198 +R NGKWR+C DYTNLNKACPK+A+P Sbjct: 45 VRKPNGKWRMCTDYTNLNKACPKDAYP 71 Score = 47.4 bits (111), Expect(3) = 2e-14 Identities = 24/45 (53%), Positives = 33/45 (73%), Gaps = 1/45 (2%) Frame = +3 Query: 195 PLPNIDKLVDNSFVLRLLSCMDAYFRYNQI-LIPTRQKKPAFMTD 326 PLPNID+LVD + + L+ +DAY RYNQI + P ++K AF+TD Sbjct: 71 PLPNIDRLVDGASGHKFLTFLDAYSRYNQIRMHPGDEEKTAFITD 115 Score = 25.4 bits (54), Expect(3) = 2e-14 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +2 Query: 71 RFCKEVKYTI*LSNVVLDKK 130 RF +EV+YT L+NVV+ +K Sbjct: 28 RFTREVQYTTWLTNVVMVRK 47 >gb|KYP58743.1| Transposon Ty3-I Gag-Pol polyprotein [Cajanus cajan] Length = 978 Score = 52.4 bits (124), Expect(3) = 3e-14 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = +1 Query: 130 NGKWRLCVDYTNLNKACPKEAFP 198 NGKWR+C DYTNLNKACPK+A+P Sbjct: 69 NGKWRMCTDYTNLNKACPKDAYP 91 Score = 46.6 bits (109), Expect(3) = 3e-14 Identities = 24/45 (53%), Positives = 33/45 (73%), Gaps = 1/45 (2%) Frame = +3 Query: 195 PLPNIDKLVDNSFVLRLLSCMDAYFRYNQI-LIPTRQKKPAFMTD 326 PLPNID+LVD + ++LS +DAY YNQI + P ++K AF+TD Sbjct: 91 PLPNIDRLVDGASGHKVLSFLDAYSGYNQIRMHPRDEEKTAFITD 135 Score = 26.6 bits (57), Expect(3) = 3e-14 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +2 Query: 71 RFCKEVKYTI*LSNVVLDKK 130 RF +EV+YT L+NVV+ KK Sbjct: 48 RFIREVQYTTWLANVVMVKK 67 >gb|KYP53505.1| Retrovirus-related Pol polyprotein from transposon 297 family [Cajanus cajan] Length = 677 Score = 53.5 bits (127), Expect(3) = 3e-14 Identities = 20/27 (74%), Positives = 24/27 (88%) Frame = +1 Query: 118 IR*KNGKWRLCVDYTNLNKACPKEAFP 198 +R NGKWR+C DYTNLNKACPK+A+P Sbjct: 65 VRKPNGKWRMCTDYTNLNKACPKDAYP 91 Score = 46.6 bits (109), Expect(3) = 3e-14 Identities = 24/45 (53%), Positives = 33/45 (73%), Gaps = 1/45 (2%) Frame = +3 Query: 195 PLPNIDKLVDNSFVLRLLSCMDAYFRYNQI-LIPTRQKKPAFMTD 326 PLPNID+LVD + + L+ +DAY RYNQI + P ++K AF+TD Sbjct: 91 PLPNIDRLVDGASGHKFLTFLDAYSRYNQIRMHPGDEEKIAFITD 135 Score = 25.4 bits (54), Expect(3) = 3e-14 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +2 Query: 71 RFCKEVKYTI*LSNVVLDKK 130 RF +EV+YT L+NVV+ +K Sbjct: 48 RFIREVQYTTWLANVVMVRK 67 >gb|KYP40860.1| Transposon Ty3-I Gag-Pol polyprotein [Cajanus cajan] Length = 288 Score = 52.4 bits (124), Expect(3) = 3e-14 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = +1 Query: 130 NGKWRLCVDYTNLNKACPKEAFP 198 NGKWR+C DYTNLNKACPK+A+P Sbjct: 41 NGKWRMCTDYTNLNKACPKDAYP 63 Score = 46.6 bits (109), Expect(3) = 3e-14 Identities = 24/45 (53%), Positives = 33/45 (73%), Gaps = 1/45 (2%) Frame = +3 Query: 195 PLPNIDKLVDNSFVLRLLSCMDAYFRYNQI-LIPTRQKKPAFMTD 326 PLPNID+LVD + ++LS +DAY YNQI + P ++K AF+TD Sbjct: 63 PLPNIDRLVDGASGHKILSFLDAYSGYNQIRMHPHDEEKTAFITD 107 Score = 26.6 bits (57), Expect(3) = 3e-14 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +2 Query: 71 RFCKEVKYTI*LSNVVLDKK 130 RF +EV+YT L+NVV+ KK Sbjct: 20 RFIREVQYTTWLANVVMVKK 39 >dbj|GAU50921.1| hypothetical protein TSUD_411180 [Trifolium subterraneum] Length = 1530 Score = 54.3 bits (129), Expect(2) = 3e-14 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 1/45 (2%) Frame = +3 Query: 195 PLPNIDKLVDNSFVLRLLSCMDAYFRYNQI-LIPTRQKKPAFMTD 326 PLPNIDKLVDNS +LLS MDAY YNQI + +KK AFMT+ Sbjct: 566 PLPNIDKLVDNSSGFKLLSFMDAYSGYNQIKMAEINKKKTAFMTE 610 Score = 51.2 bits (121), Expect(2) = 3e-14 Identities = 18/27 (66%), Positives = 25/27 (92%) Frame = +1 Query: 118 IR*KNGKWRLCVDYTNLNKACPKEAFP 198 ++ NGKWR+CVDYT+LN+ACPK+A+P Sbjct: 540 VKKSNGKWRMCVDYTDLNRACPKDAYP 566 >gb|KYP40284.1| Retrovirus-related Pol polyprotein from transposon 297 family [Cajanus cajan] Length = 783 Score = 52.4 bits (124), Expect(3) = 4e-14 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = +1 Query: 130 NGKWRLCVDYTNLNKACPKEAFP 198 NGKWR+C DYTNLNKACPK+A+P Sbjct: 69 NGKWRMCTDYTNLNKACPKDAYP 91 Score = 46.2 bits (108), Expect(3) = 4e-14 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 1/45 (2%) Frame = +3 Query: 195 PLPNIDKLVDNSFVLRLLSCMDAYFRYNQI-LIPTRQKKPAFMTD 326 PLP+ID+LVD + RLL+ +DAY YNQI + P + K AF+TD Sbjct: 91 PLPSIDRLVDGAAGHRLLTFLDAYLGYNQIRMHPQDENKTAFITD 135 Score = 26.6 bits (57), Expect(3) = 4e-14 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +2 Query: 71 RFCKEVKYTI*LSNVVLDKK 130 RF +EV+YT L+NVV+ KK Sbjct: 48 RFIREVQYTTWLANVVMVKK 67 >ref|XP_020211520.1| uncharacterized protein LOC109796248 [Cajanus cajan] Length = 962 Score = 53.5 bits (127), Expect(3) = 5e-14 Identities = 20/27 (74%), Positives = 24/27 (88%) Frame = +1 Query: 118 IR*KNGKWRLCVDYTNLNKACPKEAFP 198 +R NGKWR+C DYTNLNKACPK+A+P Sbjct: 65 VRKPNGKWRMCTDYTNLNKACPKDAYP 91 Score = 45.8 bits (107), Expect(3) = 5e-14 Identities = 23/45 (51%), Positives = 33/45 (73%), Gaps = 1/45 (2%) Frame = +3 Query: 195 PLPNIDKLVDNSFVLRLLSCMDAYFRYNQI-LIPTRQKKPAFMTD 326 PLPNID+LVD + + L+ +DAY YNQI + P+ ++K AF+TD Sbjct: 91 PLPNIDRLVDGASGHKFLTFLDAYSGYNQIRMHPSDEEKTAFITD 135 Score = 25.4 bits (54), Expect(3) = 5e-14 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +2 Query: 71 RFCKEVKYTI*LSNVVLDKK 130 RF +EV+YT L+NVV+ +K Sbjct: 48 RFIREVQYTTWLANVVMVRK 67 >gb|KYP42541.1| Retrovirus-related Pol polyprotein from transposon 297 family [Cajanus cajan] Length = 554 Score = 52.4 bits (124), Expect(3) = 5e-14 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = +1 Query: 130 NGKWRLCVDYTNLNKACPKEAFP 198 NGKWR+C DYTNLNKACPK+A+P Sbjct: 69 NGKWRMCTDYTNLNKACPKDAYP 91 Score = 47.8 bits (112), Expect(3) = 5e-14 Identities = 25/45 (55%), Positives = 33/45 (73%), Gaps = 1/45 (2%) Frame = +3 Query: 195 PLPNIDKLVDNSFVLRLLSCMDAYFRYNQI-LIPTRQKKPAFMTD 326 PLPNID+LVD + RLL+ +DAY YNQI + P ++K AF+TD Sbjct: 91 PLPNIDRLVDGAAGHRLLTFLDAYSGYNQIRMHPQDEEKTAFITD 135 Score = 24.6 bits (52), Expect(3) = 5e-14 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +2 Query: 74 FCKEVKYTI*LSNVVLDKK 130 F +EV+YT L+NVV+ KK Sbjct: 49 FIREVQYTTWLANVVMVKK 67 >gb|KYP69675.1| Retrovirus-related Pol polyprotein from transposon opus, partial [Cajanus cajan] Length = 255 Score = 53.5 bits (127), Expect(3) = 5e-14 Identities = 20/27 (74%), Positives = 24/27 (88%) Frame = +1 Query: 118 IR*KNGKWRLCVDYTNLNKACPKEAFP 198 +R NGKWR+C DYTNLNKACPK+A+P Sbjct: 74 VRKPNGKWRMCTDYTNLNKACPKDAYP 100 Score = 45.8 bits (107), Expect(3) = 5e-14 Identities = 23/45 (51%), Positives = 33/45 (73%), Gaps = 1/45 (2%) Frame = +3 Query: 195 PLPNIDKLVDNSFVLRLLSCMDAYFRYNQI-LIPTRQKKPAFMTD 326 PLPNID+LVD + + L+ +DAY YNQI + P+ ++K AF+TD Sbjct: 100 PLPNIDRLVDGASGHKFLTFLDAYSGYNQIRMHPSDEEKTAFITD 144 Score = 25.4 bits (54), Expect(3) = 5e-14 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +2 Query: 71 RFCKEVKYTI*LSNVVLDKK 130 RF +EV+YT L+NVV+ +K Sbjct: 57 RFIREVQYTTWLANVVMVRK 76 >ref|XP_020229720.1| uncharacterized protein LOC109810620 [Cajanus cajan] Length = 1628 Score = 52.4 bits (124), Expect(3) = 6e-14 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = +1 Query: 130 NGKWRLCVDYTNLNKACPKEAFP 198 NGKWR+C DYTNLNKACPK+A+P Sbjct: 706 NGKWRMCTDYTNLNKACPKDAYP 728 Score = 45.4 bits (106), Expect(3) = 6e-14 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 1/45 (2%) Frame = +3 Query: 195 PLPNIDKLVDNSFVLRLLSCMDAYFRYNQI-LIPTRQKKPAFMTD 326 PLP+ID+LVD + RLL+ +DAY YNQI + P + K AF+TD Sbjct: 728 PLPSIDRLVDGAAGHRLLTFLDAYSGYNQIRMHPQDENKTAFITD 772 Score = 26.6 bits (57), Expect(3) = 6e-14 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +2 Query: 71 RFCKEVKYTI*LSNVVLDKK 130 RF +EV+YT L+NVV+ KK Sbjct: 685 RFIREVQYTTWLANVVMVKK 704 >gb|KYP73371.1| Retrovirus-related Pol polyprotein from transposon 297 family [Cajanus cajan] Length = 760 Score = 52.4 bits (124), Expect(3) = 6e-14 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = +1 Query: 130 NGKWRLCVDYTNLNKACPKEAFP 198 NGKWR+C DYTNLNKACPK+A+P Sbjct: 69 NGKWRMCTDYTNLNKACPKDAYP 91 Score = 45.4 bits (106), Expect(3) = 6e-14 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 1/45 (2%) Frame = +3 Query: 195 PLPNIDKLVDNSFVLRLLSCMDAYFRYNQI-LIPTRQKKPAFMTD 326 PLP+ID+LVD + RLL+ +DAY YNQI + P + K AF+TD Sbjct: 91 PLPSIDRLVDGAAGHRLLTFLDAYSGYNQIRMHPQDENKTAFITD 135 Score = 26.6 bits (57), Expect(3) = 6e-14 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +2 Query: 71 RFCKEVKYTI*LSNVVLDKK 130 RF +EV+YT L+NVV+ KK Sbjct: 48 RFIREVQYTTWLANVVMVKK 67 >ref|XP_020208702.1| uncharacterized protein LOC109793653 [Cajanus cajan] Length = 1774 Score = 52.4 bits (124), Expect(3) = 8e-14 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = +1 Query: 130 NGKWRLCVDYTNLNKACPKEAFP 198 NGKWR+C DYTNLNKACPK+A+P Sbjct: 821 NGKWRMCTDYTNLNKACPKDAYP 843 Score = 45.1 bits (105), Expect(3) = 8e-14 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 1/45 (2%) Frame = +3 Query: 195 PLPNIDKLVDNSFVLRLLSCMDAYFRYNQI-LIPTRQKKPAFMTD 326 PLPNID+LVD + +L+ +DAY YNQI + P ++K AF+TD Sbjct: 843 PLPNIDRLVDGASGHNMLTFLDAYSGYNQIQMHPQDEEKTAFITD 887 Score = 26.6 bits (57), Expect(3) = 8e-14 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +2 Query: 71 RFCKEVKYTI*LSNVVLDKK 130 RF +EV+YT L+NVV+ KK Sbjct: 800 RFIREVQYTTWLANVVMVKK 819 >dbj|GAU47361.1| hypothetical protein TSUD_403640 [Trifolium subterraneum] Length = 1618 Score = 53.5 bits (127), Expect(2) = 8e-14 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 1/45 (2%) Frame = +3 Query: 195 PLPNIDKLVDNSFVLRLLSCMDAYFRYNQI-LIPTRQKKPAFMTD 326 PLPNIDKLVDNS +LLS MDAY YNQI + +KK AFMT+ Sbjct: 729 PLPNIDKLVDNSSGFKLLSFMDAYSGYNQIKMAEIDKKKTAFMTE 773 Score = 50.8 bits (120), Expect(2) = 8e-14 Identities = 18/23 (78%), Positives = 23/23 (100%) Frame = +1 Query: 130 NGKWRLCVDYTNLNKACPKEAFP 198 NGKWR+CVDYT+LN+ACPK+A+P Sbjct: 707 NGKWRMCVDYTDLNRACPKDAYP 729 >gb|KYP31840.1| Retrovirus-related Pol polyprotein from transposon 297 family [Cajanus cajan] Length = 1064 Score = 52.4 bits (124), Expect(3) = 8e-14 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = +1 Query: 130 NGKWRLCVDYTNLNKACPKEAFP 198 NGKWR+C DYTNLNKACPK+A+P Sbjct: 140 NGKWRMCTDYTNLNKACPKDAYP 162 Score = 45.1 bits (105), Expect(3) = 8e-14 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 1/45 (2%) Frame = +3 Query: 195 PLPNIDKLVDNSFVLRLLSCMDAYFRYNQI-LIPTRQKKPAFMTD 326 PLPNID+LVD + +L+ +DAY YNQI + P ++K AF+TD Sbjct: 162 PLPNIDRLVDGASGHNMLTFLDAYSGYNQIQMHPQDEEKTAFITD 206 Score = 26.6 bits (57), Expect(3) = 8e-14 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +2 Query: 71 RFCKEVKYTI*LSNVVLDKK 130 RF +EV+YT L+NVV+ KK Sbjct: 119 RFIREVQYTTWLANVVMVKK 138 >gb|KYP44698.1| Retrovirus-related Pol polyprotein from transposon 297 family [Cajanus cajan] Length = 768 Score = 52.4 bits (124), Expect(3) = 2e-13 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = +1 Query: 130 NGKWRLCVDYTNLNKACPKEAFP 198 NGKWR+C DYTNLNKACPK+A+P Sbjct: 273 NGKWRMCTDYTNLNKACPKDAYP 295 Score = 44.3 bits (103), Expect(3) = 2e-13 Identities = 23/45 (51%), Positives = 31/45 (68%), Gaps = 1/45 (2%) Frame = +3 Query: 195 PLPNIDKLVDNSFVLRLLSCMDAYFRYNQI-LIPTRQKKPAFMTD 326 PLPNID+LVD + +LL+ +DAY YNQI + P + AF+TD Sbjct: 295 PLPNIDRLVDGASGHKLLTFLDAYSGYNQIRMYPQDEVNTAFITD 339 Score = 26.2 bits (56), Expect(3) = 2e-13 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +2 Query: 71 RFCKEVKYTI*LSNVVLDKK 130 RF +EV+YT L NVV+ KK Sbjct: 252 RFIREVQYTTWLENVVMVKK 271 >gb|KYP74121.1| Retrovirus-related Pol polyprotein from transposon 297 family [Cajanus cajan] Length = 377 Score = 53.5 bits (127), Expect(3) = 2e-13 Identities = 20/27 (74%), Positives = 24/27 (88%) Frame = +1 Query: 118 IR*KNGKWRLCVDYTNLNKACPKEAFP 198 +R NGKWR+C DYTNLNKACPK+A+P Sbjct: 65 VRKPNGKWRMCTDYTNLNKACPKDAYP 91 Score = 43.9 bits (102), Expect(3) = 2e-13 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 1/45 (2%) Frame = +3 Query: 195 PLPNIDKLVDNSFVLRLLSCMDAYFRYNQI-LIPTRQKKPAFMTD 326 PLPNID+LVD + + L+ +DAY YNQI + P ++K AF+TD Sbjct: 91 PLPNIDRLVDGASGHKFLTFLDAYSGYNQIRMHPGDEEKIAFITD 135 Score = 25.4 bits (54), Expect(3) = 2e-13 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +2 Query: 71 RFCKEVKYTI*LSNVVLDKK 130 RF +EV+YT L+NVV+ +K Sbjct: 48 RFIREVQYTTWLTNVVMVRK 67 >gb|KYP66897.1| Transposon Ty3-I Gag-Pol polyprotein [Cajanus cajan] Length = 745 Score = 52.4 bits (124), Expect(3) = 2e-13 Identities = 19/27 (70%), Positives = 25/27 (92%) Frame = +1 Query: 118 IR*KNGKWRLCVDYTNLNKACPKEAFP 198 ++ NGKWR+CVDYT+LNKACPK+A+P Sbjct: 27 VKKSNGKWRMCVDYTDLNKACPKDAYP 53 Score = 43.1 bits (100), Expect(3) = 2e-13 Identities = 22/46 (47%), Positives = 33/46 (71%), Gaps = 1/46 (2%) Frame = +3 Query: 195 PLPNIDKLVDNSFVLRLLSCMDAYFRYNQILI-PTRQKKPAFMTDK 329 PLP+ID+LVD + +LS +DAY YNQIL+ P ++ AF+T++ Sbjct: 53 PLPSIDRLVDGASGYAMLSFLDAYSGYNQILMYPPDEEYTAFITEQ 98 Score = 26.9 bits (58), Expect(3) = 2e-13 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +2 Query: 74 FCKEVKYTI*LSNVVLDKK 130 F KE+KYT L+NVV+ KK Sbjct: 11 FIKEIKYTTWLANVVMVKK 29 >gb|KYP49510.1| Transposon Ty3-I Gag-Pol polyprotein [Cajanus cajan] Length = 126 Score = 52.4 bits (124), Expect(3) = 2e-13 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = +1 Query: 130 NGKWRLCVDYTNLNKACPKEAFP 198 NGKWR+C DYTNLNKACPK+A+P Sbjct: 41 NGKWRMCTDYTNLNKACPKDAYP 63 Score = 45.1 bits (105), Expect(3) = 2e-13 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 1/45 (2%) Frame = +3 Query: 195 PLPNIDKLVDNSFVLRLLSCMDAYFRYNQI-LIPTRQKKPAFMTD 326 PLPNID+LVD + +L+ +DAY YNQI + P ++K AF+TD Sbjct: 63 PLPNIDRLVDGASGHNMLTFLDAYSGYNQIQMHPQDEEKTAFITD 107 Score = 25.0 bits (53), Expect(3) = 2e-13 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = +2 Query: 71 RFCKEVKYTI*LSNVVLDKK 130 +F +E++YT L+NVV+ KK Sbjct: 20 KFIREIQYTTWLANVVMVKK 39 >gb|KYP63265.1| Retrovirus-related Pol polyprotein from transposon 297 family [Cajanus cajan] Length = 450 Score = 52.4 bits (124), Expect(3) = 4e-13 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = +1 Query: 130 NGKWRLCVDYTNLNKACPKEAFP 198 NGKWR+C DYTNLNKACPK+A+P Sbjct: 144 NGKWRMCTDYTNLNKACPKDAYP 166 Score = 44.3 bits (103), Expect(3) = 4e-13 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 1/45 (2%) Frame = +3 Query: 195 PLPNIDKLVDNSFVLRLLSCMDAYFRYNQI-LIPTRQKKPAFMTD 326 PLPNID+LVD + +L+ +DAY YNQI + P ++K AF+TD Sbjct: 166 PLPNIDRLVDGASGHNMLTFLDAYSGYNQIQMHPQDEEKIAFITD 210 Score = 25.0 bits (53), Expect(3) = 4e-13 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = +2 Query: 71 RFCKEVKYTI*LSNVVLDKK 130 +F +E++YT L+NVV+ KK Sbjct: 123 KFIREIQYTTWLANVVMVKK 142 >gb|KYP63264.1| Retrovirus-related Pol polyprotein from transposon 297 family [Cajanus cajan] Length = 347 Score = 52.4 bits (124), Expect(3) = 4e-13 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = +1 Query: 130 NGKWRLCVDYTNLNKACPKEAFP 198 NGKWR+C DYTNLNKACPK+A+P Sbjct: 41 NGKWRMCTDYTNLNKACPKDAYP 63 Score = 44.3 bits (103), Expect(3) = 4e-13 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 1/45 (2%) Frame = +3 Query: 195 PLPNIDKLVDNSFVLRLLSCMDAYFRYNQI-LIPTRQKKPAFMTD 326 PLPNID+LVD + +L+ +DAY YNQI + P ++K AF+TD Sbjct: 63 PLPNIDRLVDGASGHNMLTFLDAYSGYNQIQMHPQDEEKIAFITD 107 Score = 25.0 bits (53), Expect(3) = 4e-13 Identities = 10/20 (50%), Positives = 16/20 (80%) Frame = +2 Query: 71 RFCKEVKYTI*LSNVVLDKK 130 +F +E++YT L+NVV+ KK Sbjct: 20 KFIREIQYTTWLANVVMVKK 39