BLASTX nr result
ID: Astragalus22_contig00035586
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00035586 (416 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN06414.1| hypothetical protein glysoja_010758 [Glycine soja... 55 9e-07 gb|KHN48010.1| hypothetical protein glysoja_015480 [Glycine soja... 54 5e-06 >gb|KHN06414.1| hypothetical protein glysoja_010758 [Glycine soja] gb|KRH58998.1| hypothetical protein GLYMA_05G160200 [Glycine max] Length = 164 Score = 55.5 bits (132), Expect = 9e-07 Identities = 31/59 (52%), Positives = 37/59 (62%), Gaps = 15/59 (25%) Frame = +3 Query: 69 IFGGLGL--GFDVKDLSA-------------TQMPSIDDDVAMKQHLKSWAYAVACTVK 200 + GGL L FDV D+ + T+MP D+DVAMKQHLKSWAYAVACTV+ Sbjct: 106 VHGGLDLRFDFDVFDVESWEYQIQMLNIQRQTKMPPFDNDVAMKQHLKSWAYAVACTVR 164 >gb|KHN48010.1| hypothetical protein glysoja_015480 [Glycine soja] gb|KRH42892.1| hypothetical protein GLYMA_08G117800 [Glycine max] Length = 163 Score = 53.5 bits (127), Expect = 5e-06 Identities = 29/55 (52%), Positives = 33/55 (60%), Gaps = 11/55 (20%) Frame = +3 Query: 69 IFGGLGLGFDVKDLSA-----------TQMPSIDDDVAMKQHLKSWAYAVACTVK 200 + GG L FD D+ T+MP DD VAMKQHLKSWAYAVACTV+ Sbjct: 109 VHGGPDLRFDYFDMFKEESREYQIQWQTKMPPFDDVVAMKQHLKSWAYAVACTVR 163