BLASTX nr result
ID: Astragalus22_contig00035294
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00035294 (348 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007157553.1| hypothetical protein PHAVU_002G078900g [Phas... 58 6e-09 >ref|XP_007157553.1| hypothetical protein PHAVU_002G078900g [Phaseolus vulgaris] gb|ESW29547.1| hypothetical protein PHAVU_002G078900g [Phaseolus vulgaris] Length = 72 Score = 58.2 bits (139), Expect = 6e-09 Identities = 30/44 (68%), Positives = 35/44 (79%), Gaps = 2/44 (4%) Frame = -1 Query: 306 RVSQISMKLKSVLACKAIYVTLKFKS*RDLCT--CCNNRSHACF 181 R SQISM+ +SVLACKAI V LKFKS +D+CT C N+ SHACF Sbjct: 2 RGSQISMEWRSVLACKAINVPLKFKSQKDVCTRCCSNSSSHACF 45