BLASTX nr result
ID: Astragalus22_contig00035265
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00035265 (758 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KYP39699.1| hypothetical protein KK1_038984, partial [Cajanus... 60 8e-07 gb|KYP40810.1| hypothetical protein KK1_037856 [Cajanus cajan] 57 8e-06 >gb|KYP39699.1| hypothetical protein KK1_038984, partial [Cajanus cajan] Length = 333 Score = 60.1 bits (144), Expect = 8e-07 Identities = 28/70 (40%), Positives = 44/70 (62%) Frame = +2 Query: 200 QLNIFENIYKDRVIQEPKFLYLEFLWGENFQFLTTLNAVGLTKFLSSPEDVYPELNCVFY 379 Q + + ++ +R I +PK++ ++F GE+F+ T GL F+S VYPEL VFY Sbjct: 20 QRDRYYQLFSERNIVDPKYISIDFFEGESFECYTIFKNSGLLDFMSMTNPVYPELVRVFY 79 Query: 380 CNLQLKNGVL 409 NL+++NGVL Sbjct: 80 SNLEIRNGVL 89 >gb|KYP40810.1| hypothetical protein KK1_037856 [Cajanus cajan] Length = 316 Score = 57.0 bits (136), Expect = 8e-06 Identities = 27/70 (38%), Positives = 43/70 (61%) Frame = +2 Query: 200 QLNIFENIYKDRVIQEPKFLYLEFLWGENFQFLTTLNAVGLTKFLSSPEDVYPELNCVFY 379 Q + + ++ +R I +PK++ ++F E+F+ T GL F+S VYPEL VFY Sbjct: 48 QRDRYYQLFSERNIVDPKYISVDFFEEESFECYTIFKNSGLVDFISMKNPVYPELVRVFY 107 Query: 380 CNLQLKNGVL 409 NL+++NGVL Sbjct: 108 SNLEIRNGVL 117