BLASTX nr result
ID: Astragalus22_contig00035249
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00035249 (497 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020233800.1| mitochondrial outer membrane protein porin 2... 79 2e-14 ref|XP_007160908.1| hypothetical protein PHAVU_001G027200g [Phas... 79 2e-14 ref|XP_014503813.1| mitochondrial outer membrane protein porin 2... 79 2e-14 ref|XP_017429305.1| PREDICTED: mitochondrial outer membrane prot... 79 2e-14 gb|KRH15450.1| hypothetical protein GLYMA_14G088800 [Glycine max] 76 2e-13 ref|XP_004498999.1| PREDICTED: mitochondrial outer membrane prot... 76 2e-13 gb|ACU23163.1| unknown [Glycine max] 76 2e-13 gb|KHN36963.1| Mitochondrial outer membrane protein porin 5 [Gly... 76 2e-13 ref|XP_003557011.2| PREDICTED: mitochondrial outer membrane prot... 76 3e-13 ref|XP_019436957.1| PREDICTED: mitochondrial outer membrane prot... 75 3e-13 gb|KHN07668.1| Mitochondrial outer membrane protein porin 2 [Gly... 76 3e-13 ref|XP_006607009.1| PREDICTED: mitochondrial outer membrane prot... 76 4e-13 dbj|GAU27332.1| hypothetical protein TSUD_05580 [Trifolium subte... 75 6e-13 dbj|GAU50835.1| hypothetical protein TSUD_410950 [Trifolium subt... 75 6e-13 ref|XP_016163038.1| mitochondrial outer membrane protein porin 2... 74 7e-13 ref|XP_015972385.1| mitochondrial outer membrane protein porin 2... 74 7e-13 gb|PNY12852.1| mitochondrial outer membrane protein porin 2-like... 74 8e-13 ref|XP_016163037.1| mitochondrial outer membrane protein porin 2... 74 8e-13 ref|XP_015972384.1| mitochondrial outer membrane protein porin 2... 74 8e-13 gb|AFK40114.1| unknown [Lotus japonicus] 73 2e-12 >ref|XP_020233800.1| mitochondrial outer membrane protein porin 2-like [Cajanus cajan] ref|XP_020233801.1| mitochondrial outer membrane protein porin 2-like [Cajanus cajan] gb|KYP48669.1| hypothetical protein KK1_029651 [Cajanus cajan] Length = 277 Score = 79.0 bits (193), Expect = 2e-14 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -1 Query: 497 HGNLGALLRHELTQKSFLTISGAFETKDLYRIPKFGFSLLLKP 369 HGNLGALL+HELT+KSFLTISGAFETKDL + PKFGFSLLLKP Sbjct: 235 HGNLGALLQHELTRKSFLTISGAFETKDLDKNPKFGFSLLLKP 277 >ref|XP_007160908.1| hypothetical protein PHAVU_001G027200g [Phaseolus vulgaris] gb|ESW32902.1| hypothetical protein PHAVU_001G027200g [Phaseolus vulgaris] Length = 277 Score = 79.0 bits (193), Expect = 2e-14 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -1 Query: 497 HGNLGALLRHELTQKSFLTISGAFETKDLYRIPKFGFSLLLKP 369 HGNLGALL+HELT+KSFLTISGAFETKDL + PKFGFSLLLKP Sbjct: 235 HGNLGALLQHELTRKSFLTISGAFETKDLDKNPKFGFSLLLKP 277 >ref|XP_014503813.1| mitochondrial outer membrane protein porin 2 [Vigna radiata var. radiata] Length = 277 Score = 78.6 bits (192), Expect = 2e-14 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = -1 Query: 497 HGNLGALLRHELTQKSFLTISGAFETKDLYRIPKFGFSLLLKP 369 HGNLGALL+HELT KSFLTISGAFETKDL + PKFGFSLLLKP Sbjct: 235 HGNLGALLQHELTSKSFLTISGAFETKDLDKNPKFGFSLLLKP 277 >ref|XP_017429305.1| PREDICTED: mitochondrial outer membrane protein porin 2-like [Vigna angularis] gb|KOM48949.1| hypothetical protein LR48_Vigan07g265300 [Vigna angularis] dbj|BAT82593.1| hypothetical protein VIGAN_03263300 [Vigna angularis var. angularis] Length = 277 Score = 78.6 bits (192), Expect = 2e-14 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = -1 Query: 497 HGNLGALLRHELTQKSFLTISGAFETKDLYRIPKFGFSLLLKP 369 HGNLGALL+HELT KSFLTISGAFETKDL + PKFGFSLLLKP Sbjct: 235 HGNLGALLQHELTSKSFLTISGAFETKDLDKNPKFGFSLLLKP 277 >gb|KRH15450.1| hypothetical protein GLYMA_14G088800 [Glycine max] Length = 277 Score = 75.9 bits (185), Expect = 2e-13 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -1 Query: 497 HGNLGALLRHELTQKSFLTISGAFETKDLYRIPKFGFSLLLKP 369 HGNLGALL+HELT+KSFLTIS AFETKDL + PKFGF+LLLKP Sbjct: 235 HGNLGALLQHELTRKSFLTISSAFETKDLDKSPKFGFTLLLKP 277 >ref|XP_004498999.1| PREDICTED: mitochondrial outer membrane protein porin 2-like [Cicer arietinum] Length = 277 Score = 75.9 bits (185), Expect = 2e-13 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = -1 Query: 497 HGNLGALLRHELTQKSFLTISGAFETKDLYRIPKFGFSLLLKP 369 HGNLGALL+HELT +SFLTISGAFETK+L PKFGFSLLLKP Sbjct: 235 HGNLGALLQHELTHRSFLTISGAFETKELENSPKFGFSLLLKP 277 >gb|ACU23163.1| unknown [Glycine max] Length = 277 Score = 75.9 bits (185), Expect = 2e-13 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -1 Query: 497 HGNLGALLRHELTQKSFLTISGAFETKDLYRIPKFGFSLLLKP 369 HGNLGALL+HELT+KSFLTIS AFETKDL + PKFGF+LLLKP Sbjct: 235 HGNLGALLQHELTRKSFLTISSAFETKDLDKSPKFGFTLLLKP 277 >gb|KHN36963.1| Mitochondrial outer membrane protein porin 5 [Glycine soja] Length = 278 Score = 75.9 bits (185), Expect = 2e-13 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -1 Query: 497 HGNLGALLRHELTQKSFLTISGAFETKDLYRIPKFGFSLLLKP 369 HGNLGALL+HELT+KSFLTIS AFETKDL + PKFGF+LLLKP Sbjct: 236 HGNLGALLQHELTRKSFLTISSAFETKDLDKSPKFGFTLLLKP 278 >ref|XP_003557011.2| PREDICTED: mitochondrial outer membrane protein porin 2-like isoform X4 [Glycine max] Length = 297 Score = 75.9 bits (185), Expect = 3e-13 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -1 Query: 497 HGNLGALLRHELTQKSFLTISGAFETKDLYRIPKFGFSLLLKP 369 HGNLGALL+HELT+KSFLTIS AFETKDL + PKFGF+LLLKP Sbjct: 255 HGNLGALLQHELTRKSFLTISSAFETKDLDKSPKFGFTLLLKP 297 >ref|XP_019436957.1| PREDICTED: mitochondrial outer membrane protein porin 2-like [Lupinus angustifolius] gb|OIW15576.1| hypothetical protein TanjilG_01099 [Lupinus angustifolius] Length = 277 Score = 75.5 bits (184), Expect = 3e-13 Identities = 37/43 (86%), Positives = 38/43 (88%) Frame = -1 Query: 497 HGNLGALLRHELTQKSFLTISGAFETKDLYRIPKFGFSLLLKP 369 HGNLGALL+HEL KSFLTISGAFETK L R PKFGFSLLLKP Sbjct: 235 HGNLGALLQHELANKSFLTISGAFETKALERSPKFGFSLLLKP 277 >gb|KHN07668.1| Mitochondrial outer membrane protein porin 2 [Glycine soja] Length = 313 Score = 75.9 bits (185), Expect = 3e-13 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -1 Query: 497 HGNLGALLRHELTQKSFLTISGAFETKDLYRIPKFGFSLLLKP 369 HGNLGALL+HELT+KSFLTIS AFETKDL + PKFGF+LLLKP Sbjct: 271 HGNLGALLQHELTRKSFLTISSAFETKDLDKSPKFGFTLLLKP 313 >ref|XP_006607009.1| PREDICTED: mitochondrial outer membrane protein porin 2-like isoform X1 [Glycine max] Length = 333 Score = 75.9 bits (185), Expect = 4e-13 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -1 Query: 497 HGNLGALLRHELTQKSFLTISGAFETKDLYRIPKFGFSLLLKP 369 HGNLGALL+HELT+KSFLTIS AFETKDL + PKFGF+LLLKP Sbjct: 291 HGNLGALLQHELTRKSFLTISSAFETKDLDKSPKFGFTLLLKP 333 >dbj|GAU27332.1| hypothetical protein TSUD_05580 [Trifolium subterraneum] Length = 277 Score = 74.7 bits (182), Expect = 6e-13 Identities = 36/43 (83%), Positives = 38/43 (88%) Frame = -1 Query: 497 HGNLGALLRHELTQKSFLTISGAFETKDLYRIPKFGFSLLLKP 369 HGNLG LL+HELT KSFLTISGAFETK L + PKFGFSLLLKP Sbjct: 235 HGNLGTLLQHELTHKSFLTISGAFETKALEKSPKFGFSLLLKP 277 >dbj|GAU50835.1| hypothetical protein TSUD_410950 [Trifolium subterraneum] Length = 277 Score = 74.7 bits (182), Expect = 6e-13 Identities = 36/43 (83%), Positives = 38/43 (88%) Frame = -1 Query: 497 HGNLGALLRHELTQKSFLTISGAFETKDLYRIPKFGFSLLLKP 369 HGNLG LL+HELT KSFLTISGAFETK L + PKFGFSLLLKP Sbjct: 235 HGNLGTLLQHELTHKSFLTISGAFETKALEKSPKFGFSLLLKP 277 >ref|XP_016163038.1| mitochondrial outer membrane protein porin 2 isoform X2 [Arachis ipaensis] Length = 266 Score = 74.3 bits (181), Expect = 7e-13 Identities = 36/43 (83%), Positives = 38/43 (88%) Frame = -1 Query: 497 HGNLGALLRHELTQKSFLTISGAFETKDLYRIPKFGFSLLLKP 369 HGNLGA+L+HELT KSFLTISGAFETK L PKFGFSLLLKP Sbjct: 224 HGNLGAVLQHELTDKSFLTISGAFETKALENSPKFGFSLLLKP 266 >ref|XP_015972385.1| mitochondrial outer membrane protein porin 2 isoform X2 [Arachis duranensis] Length = 266 Score = 74.3 bits (181), Expect = 7e-13 Identities = 36/43 (83%), Positives = 38/43 (88%) Frame = -1 Query: 497 HGNLGALLRHELTQKSFLTISGAFETKDLYRIPKFGFSLLLKP 369 HGNLGA+L+HELT KSFLTISGAFETK L PKFGFSLLLKP Sbjct: 224 HGNLGAVLQHELTDKSFLTISGAFETKALENSPKFGFSLLLKP 266 >gb|PNY12852.1| mitochondrial outer membrane protein porin 2-like [Trifolium pratense] Length = 277 Score = 74.3 bits (181), Expect = 8e-13 Identities = 36/43 (83%), Positives = 37/43 (86%) Frame = -1 Query: 497 HGNLGALLRHELTQKSFLTISGAFETKDLYRIPKFGFSLLLKP 369 HGNLG LL+HELT KSFLTISGAFETK L PKFGFSLLLKP Sbjct: 235 HGNLGTLLQHELTHKSFLTISGAFETKALENTPKFGFSLLLKP 277 >ref|XP_016163037.1| mitochondrial outer membrane protein porin 2 isoform X1 [Arachis ipaensis] Length = 279 Score = 74.3 bits (181), Expect = 8e-13 Identities = 36/43 (83%), Positives = 38/43 (88%) Frame = -1 Query: 497 HGNLGALLRHELTQKSFLTISGAFETKDLYRIPKFGFSLLLKP 369 HGNLGA+L+HELT KSFLTISGAFETK L PKFGFSLLLKP Sbjct: 237 HGNLGAVLQHELTDKSFLTISGAFETKALENSPKFGFSLLLKP 279 >ref|XP_015972384.1| mitochondrial outer membrane protein porin 2 isoform X1 [Arachis duranensis] Length = 279 Score = 74.3 bits (181), Expect = 8e-13 Identities = 36/43 (83%), Positives = 38/43 (88%) Frame = -1 Query: 497 HGNLGALLRHELTQKSFLTISGAFETKDLYRIPKFGFSLLLKP 369 HGNLGA+L+HELT KSFLTISGAFETK L PKFGFSLLLKP Sbjct: 237 HGNLGAVLQHELTDKSFLTISGAFETKALENSPKFGFSLLLKP 279 >gb|AFK40114.1| unknown [Lotus japonicus] Length = 266 Score = 73.2 bits (178), Expect = 2e-12 Identities = 36/43 (83%), Positives = 38/43 (88%) Frame = -1 Query: 497 HGNLGALLRHELTQKSFLTISGAFETKDLYRIPKFGFSLLLKP 369 H NLGALL+HELT KSFLTISGAFETK L + PKFGFSLLLKP Sbjct: 224 HDNLGALLQHELTHKSFLTISGAFETKALEKNPKFGFSLLLKP 266