BLASTX nr result
ID: Astragalus22_contig00035235
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00035235 (399 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019454601.1| PREDICTED: 3-methyl-2-oxobutanoate hydroxyme... 57 8e-07 >ref|XP_019454601.1| PREDICTED: 3-methyl-2-oxobutanoate hydroxymethyltransferase 1, mitochondrial-like [Lupinus angustifolius] gb|OIW05378.1| hypothetical protein TanjilG_28843 [Lupinus angustifolius] Length = 362 Score = 57.0 bits (136), Expect = 8e-07 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = +2 Query: 2 GFLSELQKLGFDKAASAASEAVQKMVSAKPTAAGNSTK 115 GFL+ELQ+LGFDKAASAAS+AV+KM +A+P GN TK Sbjct: 325 GFLNELQRLGFDKAASAASDAVEKMNTAQPIGVGNPTK 362