BLASTX nr result
ID: Astragalus22_contig00035227
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00035227 (372 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD28426.2| RNA-directed DNA polymerase (Reverse transcriptas... 61 2e-08 gb|ABB00038.1| reverse transcriptase family member [Glycine max] 59 1e-07 gb|ACN78498.1| putative reverse transcriptase [Arachis hypogaea] 54 1e-06 gb|ABN08628.1| RNA-directed DNA polymerase (Reverse transcriptas... 55 2e-06 gb|KYP34423.1| Retrovirus-related Pol polyprotein LINE-1 [Cajanu... 54 8e-06 >gb|ABD28426.2| RNA-directed DNA polymerase (Reverse transcriptase) [Medicago truncatula] Length = 517 Score = 61.2 bits (147), Expect = 2e-08 Identities = 33/47 (70%), Positives = 35/47 (74%) Frame = +3 Query: 228 MEVIY*LGHVMERYQMD*KGMPLVFIDLEKS*DRVPREILCKALEKK 368 ME IY L VMERY+ D K + LVF DLEK DRVPREIL KALEKK Sbjct: 260 MEAIYLLQRVMERYRTDKKDLHLVFFDLEKGYDRVPREILWKALEKK 306 >gb|ABB00038.1| reverse transcriptase family member [Glycine max] Length = 377 Score = 58.9 bits (141), Expect = 1e-07 Identities = 31/47 (65%), Positives = 37/47 (78%) Frame = +3 Query: 228 MEVIY*LGHVMERYQMD*KGMPLVFIDLEKS*DRVPREILCKALEKK 368 ME IY L VME+Y+M + + L+FIDLEK+ DRVPREIL KALEKK Sbjct: 7 MEAIYLLRRVMEQYRMAQQDLHLIFIDLEKAYDRVPREILWKALEKK 53 >gb|ACN78498.1| putative reverse transcriptase [Arachis hypogaea] Length = 149 Score = 54.3 bits (129), Expect = 1e-06 Identities = 27/46 (58%), Positives = 35/46 (76%) Frame = +3 Query: 231 EVIY*LGHVMERYQMD*KGMPLVFIDLEKS*DRVPREILCKALEKK 368 E IY L +MERY+ + + + +VFIDLEK+ DRVPRE+L K LEKK Sbjct: 47 EAIYLLRRMMERYRSNKRDLHMVFIDLEKAYDRVPREVLWKVLEKK 92 >gb|ABN08628.1| RNA-directed DNA polymerase (Reverse transcriptase) [Medicago truncatula] Length = 243 Score = 55.1 bits (131), Expect = 2e-06 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +3 Query: 246 LGHVMERYQMD*KGMPLVFIDLEKS*DRVPREILCKALEKK 368 L VMERY+ D K + LVFIDLEK+ DRVPREIL KAL+KK Sbjct: 117 LRRVMERYRTDKKDLHLVFIDLEKAYDRVPREILWKALKKK 157 >gb|KYP34423.1| Retrovirus-related Pol polyprotein LINE-1 [Cajanus cajan] Length = 819 Score = 53.9 bits (128), Expect = 8e-06 Identities = 26/47 (55%), Positives = 36/47 (76%) Frame = +3 Query: 228 MEVIY*LGHVMERYQMD*KGMPLVFIDLEKS*DRVPREILCKALEKK 368 ME IY L +ME+Y+ K + +VF+DLEK+ DRVPR++L +ALEKK Sbjct: 448 MEAIYLLRRLMEQYRTQQKDLHMVFVDLEKAYDRVPRQVLWEALEKK 494