BLASTX nr result
ID: Astragalus22_contig00034493
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00034493 (452 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004497082.1| PREDICTED: VQ motif-containing protein 8, ch... 109 3e-27 gb|AFK43976.1| unknown [Lotus japonicus] 104 3e-25 gb|PNY06987.1| protein MKS1 [Trifolium pratense] 100 2e-24 dbj|GAU14819.1| hypothetical protein TSUD_50310 [Trifolium subte... 101 7e-24 gb|KHN05561.1| hypothetical protein glysoja_035761 [Glycine soja] 99 2e-23 ref|XP_003592651.1| VQ motif protein [Medicago truncatula] >gi|3... 99 3e-23 ref|XP_006589686.1| PREDICTED: VQ motif-containing protein 8, ch... 99 5e-23 gb|KHN11410.1| hypothetical protein glysoja_015305 [Glycine soja] 92 4e-21 gb|KRG90839.1| hypothetical protein GLYMA_20G116600 [Glycine max] 92 1e-20 ref|XP_006606887.1| PREDICTED: VQ motif-containing protein 8, ch... 92 2e-20 ref|XP_020237638.1| VQ motif-containing protein 8, chloroplastic... 88 1e-18 ref|XP_007142920.1| hypothetical protein PHAVU_007G028200g [Phas... 85 1e-17 gb|AFK40289.1| unknown [Lotus japonicus] 85 1e-17 gb|OIW12932.1| hypothetical protein TanjilG_15852 [Lupinus angus... 82 1e-16 ref|XP_019439153.1| PREDICTED: VQ motif-containing protein 8, ch... 82 2e-16 ref|XP_014511994.1| VQ motif-containing protein 8, chloroplastic... 80 7e-16 ref|XP_019451948.1| PREDICTED: VQ motif-containing protein 8, ch... 79 4e-15 dbj|BAT93771.1| hypothetical protein VIGAN_08030200 [Vigna angul... 79 4e-15 ref|XP_017413227.1| PREDICTED: VQ motif-containing protein 8, ch... 79 4e-15 ref|XP_019418398.1| PREDICTED: VQ motif-containing protein 8, ch... 76 5e-14 >ref|XP_004497082.1| PREDICTED: VQ motif-containing protein 8, chloroplastic [Cicer arietinum] Length = 194 Score = 109 bits (273), Expect = 3e-27 Identities = 62/98 (63%), Positives = 70/98 (71%), Gaps = 13/98 (13%) Frame = +2 Query: 5 EKYWNQSH---DGDETSSALRK--REGEICVKGGA-----ISPSINLNFADMPLFTPTSY 154 EK W Q DGDET+S R GE C KGG +PS N+NFADMPLFTPTSY Sbjct: 98 EKMWMQQDHVSDGDETTSKTNSVLRRGENCDKGGVNNVDQYNPS-NVNFADMPLFTPTSY 156 Query: 155 DFLCSS---YKFSESPYGILGSLISPSGLGFIKDLPEY 259 DF CSS Y+FS+SP+GILGSLISP+GLGFIK+LPEY Sbjct: 157 DFFCSSKPVYQFSDSPFGILGSLISPAGLGFIKELPEY 194 >gb|AFK43976.1| unknown [Lotus japonicus] Length = 194 Score = 104 bits (260), Expect = 3e-25 Identities = 62/87 (71%), Positives = 69/87 (79%), Gaps = 10/87 (11%) Frame = +2 Query: 29 DGDETSSALRKREGEICVKGGAI-----SPSINLNFADMPLFTP-TSYDFLCSS----YK 178 DGDETSSALR R+GE CVKG SPSI L+FA+MPLFTP +S DF CSS Y+ Sbjct: 110 DGDETSSALR-RDGEDCVKGVGANVQLQSPSI-LDFANMPLFTPNSSSDFFCSSSRPVYQ 167 Query: 179 FSESPYGILGSLISPSGLGFIKDLPEY 259 FS+SPYGILGSLISPSGLGFIKDLP+Y Sbjct: 168 FSDSPYGILGSLISPSGLGFIKDLPDY 194 >gb|PNY06987.1| protein MKS1 [Trifolium pratense] Length = 135 Score = 100 bits (250), Expect = 2e-24 Identities = 57/96 (59%), Positives = 66/96 (68%), Gaps = 20/96 (20%) Frame = +2 Query: 32 GDETSSALR---KRE----GEICVKGGAIS--------PSINLNFADMPLFTPTSYDFLC 166 GDET+S + KRE E C KGG S P+ +NFADMPL+TPTSYDF C Sbjct: 40 GDETTSTISSIVKREHININESCEKGGVTSNVDDQQHSPNNMMNFADMPLYTPTSYDFFC 99 Query: 167 SS-----YKFSESPYGILGSLISPSGLGFIKDLPEY 259 S+ Y+FS+SPYGILGSLISPSGLGFI+DLPEY Sbjct: 100 SNSSRPVYQFSDSPYGILGSLISPSGLGFIQDLPEY 135 >dbj|GAU14819.1| hypothetical protein TSUD_50310 [Trifolium subterraneum] Length = 198 Score = 101 bits (251), Expect = 7e-24 Identities = 60/97 (61%), Positives = 68/97 (70%), Gaps = 21/97 (21%) Frame = +2 Query: 32 GDETSS---ALRKREG----EICVKGGAIS--------PSINL-NFADMPLFTPTSYDFL 163 GDET+S ++ KRE E C KGG S PS N+ NFADMPLFTPTSYDF Sbjct: 102 GDETTSTTSSIVKRENININESCEKGGVTSNVDDQQHSPSNNMMNFADMPLFTPTSYDFF 161 Query: 164 CSS-----YKFSESPYGILGSLISPSGLGFIKDLPEY 259 CS+ Y+FS+SPYGILGSLISPSGLGFI+DLPEY Sbjct: 162 CSNSSKPVYQFSDSPYGILGSLISPSGLGFIQDLPEY 198 >gb|KHN05561.1| hypothetical protein glysoja_035761 [Glycine soja] Length = 164 Score = 99.0 bits (245), Expect = 2e-23 Identities = 56/86 (65%), Positives = 67/86 (77%), Gaps = 7/86 (8%) Frame = +2 Query: 23 SHDGDETSSALRKREGEICVKGGAI---SPSINLNFADMPLFTPTSYDFLCSS----YKF 181 +++ +ETSSALR R GE V+ GAI PS NL+FADMPLFTP S DF CSS YK+ Sbjct: 81 NYNSNETSSALR-RVGENLVESGAIVQHGPS-NLDFADMPLFTPNSSDFFCSSGSSVYKY 138 Query: 182 SESPYGILGSLISPSGLGFIKDLPEY 259 S+SPYG+LGSLISPSGL F+K+LPEY Sbjct: 139 SDSPYGVLGSLISPSGLEFMKELPEY 164 >ref|XP_003592651.1| VQ motif protein [Medicago truncatula] gb|AES62902.1| VQ motif protein [Medicago truncatula] Length = 190 Score = 99.4 bits (246), Expect = 3e-23 Identities = 58/96 (60%), Positives = 68/96 (70%), Gaps = 17/96 (17%) Frame = +2 Query: 23 SHDGDETSS--ALRKREGEI---CVKGGAIS-------PSINLNFADMPLFTPTSYDFLC 166 +++GDET+S ++ KRE I C KGG S PS + FADMPLFTPTS+DF C Sbjct: 95 NNNGDETTSTSSVIKREYNIDENCDKGGVNSNVDYKHSPSNMMKFADMPLFTPTSHDFFC 154 Query: 167 SS-----YKFSESPYGILGSLISPSGLGFIKDLPEY 259 S YKFS+SPYGILGSLISPSGLGFI+DLPEY Sbjct: 155 SPSSRPVYKFSDSPYGILGSLISPSGLGFIQDLPEY 190 >ref|XP_006589686.1| PREDICTED: VQ motif-containing protein 8, chloroplastic-like [Glycine max] gb|KRH35939.1| hypothetical protein GLYMA_10G273300 [Glycine max] Length = 191 Score = 99.0 bits (245), Expect = 5e-23 Identities = 56/86 (65%), Positives = 67/86 (77%), Gaps = 7/86 (8%) Frame = +2 Query: 23 SHDGDETSSALRKREGEICVKGGAI---SPSINLNFADMPLFTPTSYDFLCSS----YKF 181 +++ +ETSSALR R GE V+ GAI PS NL+FADMPLFTP S DF CSS YK+ Sbjct: 108 NYNSNETSSALR-RVGENLVESGAIVQHGPS-NLDFADMPLFTPNSSDFFCSSGSSVYKY 165 Query: 182 SESPYGILGSLISPSGLGFIKDLPEY 259 S+SPYG+LGSLISPSGL F+K+LPEY Sbjct: 166 SDSPYGVLGSLISPSGLEFMKELPEY 191 >gb|KHN11410.1| hypothetical protein glysoja_015305 [Glycine soja] Length = 123 Score = 92.0 bits (227), Expect = 4e-21 Identities = 53/86 (61%), Positives = 65/86 (75%), Gaps = 7/86 (8%) Frame = +2 Query: 23 SHDGDETSSALRKREGEICVKGGAI---SPSINLNFADMPLFTPTSYDFLCSS----YKF 181 +++ +ETSSALR R GE V+ GAI PS +L+F DMPL TP S DF CSS YK+ Sbjct: 40 NYNSNETSSALR-RFGENLVESGAIIQHGPS-HLDFVDMPLSTPNSSDFFCSSRSSVYKY 97 Query: 182 SESPYGILGSLISPSGLGFIKDLPEY 259 S+SPYG+LGSLISPSGL F+K+LPEY Sbjct: 98 SDSPYGVLGSLISPSGLEFMKELPEY 123 >gb|KRG90839.1| hypothetical protein GLYMA_20G116600 [Glycine max] Length = 157 Score = 92.0 bits (227), Expect = 1e-20 Identities = 53/86 (61%), Positives = 65/86 (75%), Gaps = 7/86 (8%) Frame = +2 Query: 23 SHDGDETSSALRKREGEICVKGGAI---SPSINLNFADMPLFTPTSYDFLCSS----YKF 181 +++ +ETSSALR R GE V+ GAI PS +L+F DMPL TP S DF CSS YK+ Sbjct: 74 NYNSNETSSALR-RFGENLVESGAIIQHGPS-HLDFVDMPLSTPNSSDFFCSSRSSVYKY 131 Query: 182 SESPYGILGSLISPSGLGFIKDLPEY 259 S+SPYG+LGSLISPSGL F+K+LPEY Sbjct: 132 SDSPYGVLGSLISPSGLEFMKELPEY 157 >ref|XP_006606887.1| PREDICTED: VQ motif-containing protein 8, chloroplastic-like [Glycine max] Length = 179 Score = 92.0 bits (227), Expect = 2e-20 Identities = 53/86 (61%), Positives = 65/86 (75%), Gaps = 7/86 (8%) Frame = +2 Query: 23 SHDGDETSSALRKREGEICVKGGAI---SPSINLNFADMPLFTPTSYDFLCSS----YKF 181 +++ +ETSSALR R GE V+ GAI PS +L+F DMPL TP S DF CSS YK+ Sbjct: 96 NYNSNETSSALR-RFGENLVESGAIIQHGPS-HLDFVDMPLSTPNSSDFFCSSRSSVYKY 153 Query: 182 SESPYGILGSLISPSGLGFIKDLPEY 259 S+SPYG+LGSLISPSGL F+K+LPEY Sbjct: 154 SDSPYGVLGSLISPSGLEFMKELPEY 179 >ref|XP_020237638.1| VQ motif-containing protein 8, chloroplastic-like [Cajanus cajan] gb|KYP44500.1| Protein MKS1 [Cajanus cajan] Length = 191 Score = 87.8 bits (216), Expect = 1e-18 Identities = 49/84 (58%), Positives = 61/84 (72%), Gaps = 3/84 (3%) Frame = +2 Query: 17 NQSHDGDETSSALRKREGEICVKGGAISPSINLNFADMPLFTPTSYDFLCSS---YKFSE 187 + ++ +ETSSALR+ GE SPS +L+F DMPLFTP S DF CSS +K+S+ Sbjct: 111 SNNNSNNETSSALRR--GEYDSTNVQRSPS-HLDFVDMPLFTPNSSDFFCSSRSMFKYSD 167 Query: 188 SPYGILGSLISPSGLGFIKDLPEY 259 SPYG+LGSLISPS L FIK+LPEY Sbjct: 168 SPYGVLGSLISPSALEFIKELPEY 191 >ref|XP_007142920.1| hypothetical protein PHAVU_007G028200g [Phaseolus vulgaris] gb|ESW14914.1| hypothetical protein PHAVU_007G028200g [Phaseolus vulgaris] Length = 196 Score = 85.1 bits (209), Expect = 1e-17 Identities = 48/85 (56%), Positives = 61/85 (71%), Gaps = 6/85 (7%) Frame = +2 Query: 23 SHDGDETSSALRKREGEICVKGGAISPSI--NLNFADMPLFTPTSYDFLCSS----YKFS 184 +++ +ETSSALR R GE + GAI P +L+FADMPLFTP D CSS +K+S Sbjct: 113 NNNSNETSSALR-RGGENLFQSGAIVPCSPSHLDFADMPLFTPNPSDLFCSSRSSVFKYS 171 Query: 185 ESPYGILGSLISPSGLGFIKDLPEY 259 +SPYG+LGSLISPS L F+K+L EY Sbjct: 172 DSPYGVLGSLISPSALEFMKELSEY 196 >gb|AFK40289.1| unknown [Lotus japonicus] Length = 190 Score = 84.7 bits (208), Expect = 1e-17 Identities = 46/76 (60%), Positives = 53/76 (69%) Frame = +2 Query: 32 GDETSSALRKREGEICVKGGAISPSINLNFADMPLFTPTSYDFLCSSYKFSESPYGILGS 211 GDETSS L+ E CVK S +FADMPLFTP D S +K+SESPYGILGS Sbjct: 117 GDETSSVLKG--SETCVKEEPFVLSNLFSFADMPLFTPNFSDSTRSVFKYSESPYGILGS 174 Query: 212 LISPSGLGFIKDLPEY 259 L+SPSGL F+K+LPEY Sbjct: 175 LLSPSGLEFMKELPEY 190 >gb|OIW12932.1| hypothetical protein TanjilG_15852 [Lupinus angustifolius] Length = 178 Score = 82.0 bits (201), Expect = 1e-16 Identities = 51/96 (53%), Positives = 61/96 (63%), Gaps = 10/96 (10%) Frame = +2 Query: 2 KEKYWNQS--HDGDETSSALRKRE-GEICVKGGA----ISPSINLNFADMPLFTPTSYDF 160 + KY N S G ET ++K + E VK GA SPS + FADMPL TP S F Sbjct: 83 ESKYNNNSSKEGGSETEICVKKEDYDETLVKWGANVENSSPSNIMRFADMPLCTPNSSHF 142 Query: 161 LCSS---YKFSESPYGILGSLISPSGLGFIKDLPEY 259 CSS +K S++PYGILGSLISPSGL F+K+LPEY Sbjct: 143 FCSSRSVFKCSDNPYGILGSLISPSGLEFMKELPEY 178 >ref|XP_019439153.1| PREDICTED: VQ motif-containing protein 8, chloroplastic-like [Lupinus angustifolius] Length = 195 Score = 82.0 bits (201), Expect = 2e-16 Identities = 51/96 (53%), Positives = 61/96 (63%), Gaps = 10/96 (10%) Frame = +2 Query: 2 KEKYWNQS--HDGDETSSALRKRE-GEICVKGGA----ISPSINLNFADMPLFTPTSYDF 160 + KY N S G ET ++K + E VK GA SPS + FADMPL TP S F Sbjct: 100 ESKYNNNSSKEGGSETEICVKKEDYDETLVKWGANVENSSPSNIMRFADMPLCTPNSSHF 159 Query: 161 LCSS---YKFSESPYGILGSLISPSGLGFIKDLPEY 259 CSS +K S++PYGILGSLISPSGL F+K+LPEY Sbjct: 160 FCSSRSVFKCSDNPYGILGSLISPSGLEFMKELPEY 195 >ref|XP_014511994.1| VQ motif-containing protein 8, chloroplastic [Vigna radiata var. radiata] Length = 196 Score = 80.5 bits (197), Expect = 7e-16 Identities = 46/85 (54%), Positives = 60/85 (70%), Gaps = 6/85 (7%) Frame = +2 Query: 23 SHDGDETSSALRKREGEICVKGGAISPSI--NLNFADMPLFTPTSYDFLCSS----YKFS 184 +++ +ETSSALR R E ++ GAI P +L+FADMPLFTP D SS +K+S Sbjct: 113 NNNSNETSSALR-RGAENLIENGAIVPCSPSHLDFADMPLFTPNPSDLFSSSRSSVFKYS 171 Query: 185 ESPYGILGSLISPSGLGFIKDLPEY 259 +SPYG+LGSLISPS L F+K+L EY Sbjct: 172 DSPYGVLGSLISPSALEFMKELSEY 196 >ref|XP_019451948.1| PREDICTED: VQ motif-containing protein 8, chloroplastic-like [Lupinus angustifolius] gb|OIW06939.1| hypothetical protein TanjilG_18327 [Lupinus angustifolius] Length = 194 Score = 78.6 bits (192), Expect = 4e-15 Identities = 48/94 (51%), Positives = 57/94 (60%), Gaps = 10/94 (10%) Frame = +2 Query: 8 KYWNQSHDGDETSSALRKRE--GEICVKGGA-----ISPSINLNFADMPLFTPTSYDFLC 166 KY N S + S KRE G+ VK + SPS L F DMP +TP S DF C Sbjct: 101 KYDNISTEDQGASEICVKREDDGDTLVKWDSNVDQNSSPSNILRFVDMPFYTPNSSDFFC 160 Query: 167 SS---YKFSESPYGILGSLISPSGLGFIKDLPEY 259 +S +K S+ PYGILGSLISPSGL F+K+LPEY Sbjct: 161 TSRSTFKCSDHPYGILGSLISPSGLDFMKELPEY 194 >dbj|BAT93771.1| hypothetical protein VIGAN_08030200 [Vigna angularis var. angularis] Length = 194 Score = 78.6 bits (192), Expect = 4e-15 Identities = 45/85 (52%), Positives = 59/85 (69%), Gaps = 6/85 (7%) Frame = +2 Query: 23 SHDGDETSSALRKREGEICVKGGAISPSI--NLNFADMPLFTPTSYDFLCSS----YKFS 184 +++ +ETSSA R GE ++ GAI P +L+FADMPLFTP D SS +K+S Sbjct: 113 NNNSNETSSA---RGGENLIENGAIVPCSPSHLDFADMPLFTPNPSDLFSSSRSSVFKYS 169 Query: 185 ESPYGILGSLISPSGLGFIKDLPEY 259 +SPYG+LGSLISPS L F+K+L EY Sbjct: 170 DSPYGVLGSLISPSALEFMKELSEY 194 >ref|XP_017413227.1| PREDICTED: VQ motif-containing protein 8, chloroplastic [Vigna angularis] gb|KOM36318.1| hypothetical protein LR48_Vigan02g246800 [Vigna angularis] Length = 194 Score = 78.6 bits (192), Expect = 4e-15 Identities = 45/85 (52%), Positives = 59/85 (69%), Gaps = 6/85 (7%) Frame = +2 Query: 23 SHDGDETSSALRKREGEICVKGGAISPSI--NLNFADMPLFTPTSYDFLCSS----YKFS 184 +++ +ETSSA R GE ++ GAI P +L+FADMPLFTP D SS +K+S Sbjct: 113 NNNSNETSSA---RGGENLIENGAIVPCSPSHLDFADMPLFTPNPSDLFSSSRSSVFKYS 169 Query: 185 ESPYGILGSLISPSGLGFIKDLPEY 259 +SPYG+LGSLISPS L F+K+L EY Sbjct: 170 DSPYGVLGSLISPSALEFMKELSEY 194 >ref|XP_019418398.1| PREDICTED: VQ motif-containing protein 8, chloroplastic-like [Lupinus angustifolius] gb|OIW16698.1| hypothetical protein TanjilG_28755 [Lupinus angustifolius] Length = 205 Score = 75.9 bits (185), Expect = 5e-14 Identities = 44/80 (55%), Positives = 54/80 (67%), Gaps = 6/80 (7%) Frame = +2 Query: 38 ETSSALRKREGEICVKGGAI---SPSINLNFADMPLFTPTSYDFLCSS---YKFSESPYG 199 ETSS + E CVK + + S L F+DMPLFT S DF SS YK+S+SPYG Sbjct: 126 ETSSGSLTHDSETCVKEESHVQDNHSNILGFSDMPLFTTDSSDFHFSSRSVYKYSDSPYG 185 Query: 200 ILGSLISPSGLGFIKDLPEY 259 ILGSL+SP+GL F+K+LPEY Sbjct: 186 ILGSLLSPTGLEFMKELPEY 205