BLASTX nr result
ID: Astragalus22_contig00034427
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00034427 (305 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX79844.1| protein FAR1-related sequence 3-like, partial [Tr... 62 6e-09 dbj|GAU48367.1| hypothetical protein TSUD_282670 [Trifolium subt... 56 6e-07 dbj|GAU38781.1| hypothetical protein TSUD_279340 [Trifolium subt... 54 2e-06 >gb|PNX79844.1| protein FAR1-related sequence 3-like, partial [Trifolium pratense] Length = 297 Score = 61.6 bits (148), Expect = 6e-09 Identities = 34/85 (40%), Positives = 48/85 (56%) Frame = -1 Query: 299 RDPDLISTYVGIVERCKKMATASVQIGKPEFFP*TIEFIKTYTSYLEAVGRGEDIEIPCP 120 R+P I+TYV VERCK+M A + GK E TIE ++ +TS LEA+GRGE ++ Sbjct: 149 RNPAFITTYVTFVERCKRMVKAEFECGKLEHIRSTIEMVEKHTSVLEAMGRGESDDMHSL 208 Query: 119 DSYNDDTIKHPLQARSKGCGAPSLS 45 ++ +P + R KG S S Sbjct: 209 GLQTGRSVGNPPRYRKKGRAVASSS 233 >dbj|GAU48367.1| hypothetical protein TSUD_282670 [Trifolium subterraneum] Length = 608 Score = 56.2 bits (134), Expect = 6e-07 Identities = 27/53 (50%), Positives = 36/53 (67%) Frame = -1 Query: 299 RDPDLISTYVGIVERCKKMATASVQIGKPEFFP*TIEFIKTYTSYLEAVGRGE 141 RDP I+TYV VERCK+M A+ GK E TIE ++ +T+ LEA+G+GE Sbjct: 479 RDPAFITTYVMFVERCKRMVKAAFDCGKLEDIRSTIEMVEKHTTVLEAIGKGE 531 >dbj|GAU38781.1| hypothetical protein TSUD_279340 [Trifolium subterraneum] Length = 189 Score = 53.9 bits (128), Expect = 2e-06 Identities = 28/68 (41%), Positives = 43/68 (63%) Frame = -1 Query: 245 MATASVQIGKPEFFP*TIEFIKTYTSYLEAVGRGEDIEIPCPDSYNDDTIKHPLQARSKG 66 MA A+V+ GK E+ T+E I +T+ LEA+G+G+++ D Y D T+K+ ++R KG Sbjct: 1 MAKAAVECGKQEYVRTTMELISNHTNMLEAMGKGDEMAHAFNDPYIDGTLKNLTRSRRKG 60 Query: 65 CGAPSLSQ 42 G S SQ Sbjct: 61 FGIASSSQ 68