BLASTX nr result
ID: Astragalus22_contig00034394
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00034394 (312 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN42349.1| hypothetical protein glysoja_020061 [Glycine soja... 54 2e-07 ref|XP_007143067.1| hypothetical protein PHAVU_007G041100g [Phas... 53 3e-07 gb|KRH77953.1| hypothetical protein GLYMA_01G244000 [Glycine max] 52 8e-07 >gb|KHN42349.1| hypothetical protein glysoja_020061 [Glycine soja] gb|KRG91041.1| hypothetical protein GLYMA_20G130100 [Glycine max] Length = 63 Score = 53.9 bits (128), Expect = 2e-07 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = +1 Query: 28 SYSLNVEAMRPLKDQSS-PSFTSLVLNQQAYSGPSHRGRGH 147 SYS NVE+ R LKDQSS P+F L++N+ AYSGPSHRG GH Sbjct: 24 SYSNNVESTRTLKDQSSSPAFIGLIINR-AYSGPSHRGAGH 63 >ref|XP_007143067.1| hypothetical protein PHAVU_007G041100g [Phaseolus vulgaris] gb|ESW15061.1| hypothetical protein PHAVU_007G041100g [Phaseolus vulgaris] Length = 58 Score = 53.1 bits (126), Expect = 3e-07 Identities = 29/41 (70%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = +1 Query: 28 SYSLNVEAMRPLKDQ-SSPSFTSLVLNQQAYSGPSHRGRGH 147 SYS VEA + LKDQ SSPSF +L +N+ AYSGPSHRGRGH Sbjct: 19 SYSNYVEARKSLKDQYSSPSFIALFINR-AYSGPSHRGRGH 58 >gb|KRH77953.1| hypothetical protein GLYMA_01G244000 [Glycine max] Length = 59 Score = 52.0 bits (123), Expect = 8e-07 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +1 Query: 34 SLNVEAMRPLKDQSSPSFTSLVLNQQAYSGPSHRGRGH 147 S+ VE MRPLK + PSF SL++N+ AYSGPSHRGRGH Sbjct: 25 SIKVEGMRPLK--ADPSFISLIINR-AYSGPSHRGRGH 59