BLASTX nr result
ID: Astragalus22_contig00034187
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00034187 (282 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAT88712.1| hypothetical protein VIGAN_05229400 [Vigna angul... 86 3e-19 ref|XP_020962297.1| probable aspartic protease At2g35615 [Arachi... 84 1e-18 gb|KHN15325.1| Aspartic proteinase nepenthesin-1 [Glycine soja] ... 88 2e-18 ref|XP_003547445.1| PREDICTED: aspartic proteinase CDR1-like [Gl... 88 2e-18 gb|OIV97414.1| hypothetical protein TanjilG_16175 [Lupinus angus... 87 4e-18 ref|XP_014500726.1| aspartic proteinase CDR1-like [Vigna radiata... 87 6e-18 ref|XP_017421853.1| PREDICTED: aspartic proteinase CDR1-like [Vi... 87 6e-18 gb|KHN35799.1| Aspartic proteinase nepenthesin-1 [Glycine soja] 87 6e-18 gb|KRH37310.1| hypothetical protein GLYMA_09G058300 [Glycine max] 87 6e-18 ref|XP_019416591.1| PREDICTED: aspartic proteinase CDR1-like [Lu... 87 6e-18 ref|XP_003534895.1| PREDICTED: aspartic proteinase CDR1-like [Gl... 87 8e-18 ref|XP_017438057.1| PREDICTED: aspartic proteinase CDR1-like [Vi... 86 1e-17 gb|KOM54798.1| hypothetical protein LR48_Vigan10g069000 [Vigna a... 86 1e-17 ref|XP_014522132.1| aspartyl protease UND-like [Vigna radiata va... 86 1e-17 ref|XP_016198115.1| aspartic proteinase CDR1 [Arachis ipaensis] 85 3e-17 ref|XP_015959995.1| aspartic proteinase CDR1 [Arachis duranensis] 85 3e-17 gb|KYP62289.1| Aspartic proteinase nepenthesin-1 [Cajanus cajan] 85 3e-17 ref|XP_020221035.1| aspartic proteinase CDR1-like [Cajanus cajan] 85 4e-17 ref|XP_007138783.1| hypothetical protein PHAVU_009G237100g [Phas... 85 4e-17 ref|XP_015935145.1| aspartic proteinase CDR1-like [Arachis duran... 83 2e-16 >dbj|BAT88712.1| hypothetical protein VIGAN_05229400 [Vigna angularis var. angularis] Length = 163 Score = 86.3 bits (212), Expect = 3e-19 Identities = 37/52 (71%), Positives = 45/52 (86%) Frame = -2 Query: 281 VFCMTVGPINEAGIGNVPSVIGLLAQQSYNVGYDLVNGFIYFQRIDCELLSG 126 +FCMT+GP + I + PS++GLLAQQSYNVGYDLVN ++YFQRIDCELLSG Sbjct: 112 IFCMTIGPASNIDIKSRPSIVGLLAQQSYNVGYDLVNNYVYFQRIDCELLSG 163 >ref|XP_020962297.1| probable aspartic protease At2g35615 [Arachis ipaensis] Length = 138 Score = 84.0 bits (206), Expect = 1e-18 Identities = 37/52 (71%), Positives = 43/52 (82%) Frame = -2 Query: 281 VFCMTVGPINEAGIGNVPSVIGLLAQQSYNVGYDLVNGFIYFQRIDCELLSG 126 VFCM +GP++ G+ N SVIGLLAQQ YNVGYDLVN +YFQRIDC+LLSG Sbjct: 87 VFCMAIGPVSATGVDNRSSVIGLLAQQGYNVGYDLVNQIVYFQRIDCQLLSG 138 >gb|KHN15325.1| Aspartic proteinase nepenthesin-1 [Glycine soja] gb|KRH12292.1| hypothetical protein GLYMA_15G164500 [Glycine max] Length = 388 Score = 88.2 bits (217), Expect = 2e-18 Identities = 40/52 (76%), Positives = 46/52 (88%) Frame = -2 Query: 281 VFCMTVGPINEAGIGNVPSVIGLLAQQSYNVGYDLVNGFIYFQRIDCELLSG 126 VFCMTVGP++ I + PS+IGLLAQQSYNVGYDLVN F+YFQRIDCELL+G Sbjct: 337 VFCMTVGPVSSLNIKSKPSLIGLLAQQSYNVGYDLVNQFVYFQRIDCELLTG 388 >ref|XP_003547445.1| PREDICTED: aspartic proteinase CDR1-like [Glycine max] Length = 447 Score = 88.2 bits (217), Expect = 2e-18 Identities = 40/52 (76%), Positives = 46/52 (88%) Frame = -2 Query: 281 VFCMTVGPINEAGIGNVPSVIGLLAQQSYNVGYDLVNGFIYFQRIDCELLSG 126 VFCMTVGP++ I + PS+IGLLAQQSYNVGYDLVN F+YFQRIDCELL+G Sbjct: 396 VFCMTVGPVSSLNIKSKPSLIGLLAQQSYNVGYDLVNQFVYFQRIDCELLTG 447 >gb|OIV97414.1| hypothetical protein TanjilG_16175 [Lupinus angustifolius] Length = 390 Score = 87.0 bits (214), Expect = 4e-18 Identities = 40/51 (78%), Positives = 46/51 (90%) Frame = -2 Query: 281 VFCMTVGPINEAGIGNVPSVIGLLAQQSYNVGYDLVNGFIYFQRIDCELLS 129 +FCMT+ PI+ AGI + PSVIGLLAQQSYNVGYDL++ FIYFQRIDCELLS Sbjct: 339 IFCMTIAPISVAGITSKPSVIGLLAQQSYNVGYDLIDQFIYFQRIDCELLS 389 >ref|XP_014500726.1| aspartic proteinase CDR1-like [Vigna radiata var. radiata] Length = 445 Score = 87.0 bits (214), Expect = 6e-18 Identities = 38/52 (73%), Positives = 45/52 (86%) Frame = -2 Query: 281 VFCMTVGPINEAGIGNVPSVIGLLAQQSYNVGYDLVNGFIYFQRIDCELLSG 126 +FCMT+GP + I + PSV+GLLAQQSYNVGYDLVN ++YFQRIDCELLSG Sbjct: 394 IFCMTIGPASNIDIKSKPSVVGLLAQQSYNVGYDLVNNYVYFQRIDCELLSG 445 >ref|XP_017421853.1| PREDICTED: aspartic proteinase CDR1-like [Vigna angularis] gb|KOM39849.1| hypothetical protein LR48_Vigan04g004700 [Vigna angularis] dbj|BAT80133.1| hypothetical protein VIGAN_02310900 [Vigna angularis var. angularis] Length = 445 Score = 87.0 bits (214), Expect = 6e-18 Identities = 38/52 (73%), Positives = 45/52 (86%) Frame = -2 Query: 281 VFCMTVGPINEAGIGNVPSVIGLLAQQSYNVGYDLVNGFIYFQRIDCELLSG 126 +FCMT+GP + I + PSV+GLLAQQSYNVGYDLVN ++YFQRIDCELLSG Sbjct: 394 IFCMTIGPASNIDIKSKPSVVGLLAQQSYNVGYDLVNNYVYFQRIDCELLSG 445 >gb|KHN35799.1| Aspartic proteinase nepenthesin-1 [Glycine soja] Length = 389 Score = 86.7 bits (213), Expect = 6e-18 Identities = 39/52 (75%), Positives = 46/52 (88%) Frame = -2 Query: 281 VFCMTVGPINEAGIGNVPSVIGLLAQQSYNVGYDLVNGFIYFQRIDCELLSG 126 VFCMTVGP++ + + PS+IGLLAQQSY+VGYDLVN F+YFQRIDCELLSG Sbjct: 338 VFCMTVGPVSSLNLKSKPSLIGLLAQQSYSVGYDLVNQFVYFQRIDCELLSG 389 >gb|KRH37310.1| hypothetical protein GLYMA_09G058300 [Glycine max] Length = 390 Score = 86.7 bits (213), Expect = 6e-18 Identities = 39/52 (75%), Positives = 46/52 (88%) Frame = -2 Query: 281 VFCMTVGPINEAGIGNVPSVIGLLAQQSYNVGYDLVNGFIYFQRIDCELLSG 126 VFCMTVGP++ + + PS+IGLLAQQSY+VGYDLVN F+YFQRIDCELLSG Sbjct: 338 VFCMTVGPVSSLNLKSKPSLIGLLAQQSYSVGYDLVNQFVYFQRIDCELLSG 389 >ref|XP_019416591.1| PREDICTED: aspartic proteinase CDR1-like [Lupinus angustifolius] Length = 483 Score = 87.0 bits (214), Expect = 6e-18 Identities = 40/51 (78%), Positives = 46/51 (90%) Frame = -2 Query: 281 VFCMTVGPINEAGIGNVPSVIGLLAQQSYNVGYDLVNGFIYFQRIDCELLS 129 +FCMT+ PI+ AGI + PSVIGLLAQQSYNVGYDL++ FIYFQRIDCELLS Sbjct: 432 IFCMTIAPISVAGITSKPSVIGLLAQQSYNVGYDLIDQFIYFQRIDCELLS 482 >ref|XP_003534895.1| PREDICTED: aspartic proteinase CDR1-like [Glycine max] Length = 449 Score = 86.7 bits (213), Expect = 8e-18 Identities = 39/52 (75%), Positives = 46/52 (88%) Frame = -2 Query: 281 VFCMTVGPINEAGIGNVPSVIGLLAQQSYNVGYDLVNGFIYFQRIDCELLSG 126 VFCMTVGP++ + + PS+IGLLAQQSY+VGYDLVN F+YFQRIDCELLSG Sbjct: 397 VFCMTVGPVSSLNLKSKPSLIGLLAQQSYSVGYDLVNQFVYFQRIDCELLSG 448 >ref|XP_017438057.1| PREDICTED: aspartic proteinase CDR1-like [Vigna angularis] Length = 429 Score = 86.3 bits (212), Expect = 1e-17 Identities = 37/52 (71%), Positives = 45/52 (86%) Frame = -2 Query: 281 VFCMTVGPINEAGIGNVPSVIGLLAQQSYNVGYDLVNGFIYFQRIDCELLSG 126 +FCMT+GP + I + PS++GLLAQQSYNVGYDLVN ++YFQRIDCELLSG Sbjct: 378 IFCMTIGPASNIDIKSRPSIVGLLAQQSYNVGYDLVNNYVYFQRIDCELLSG 429 >gb|KOM54798.1| hypothetical protein LR48_Vigan10g069000 [Vigna angularis] Length = 445 Score = 86.3 bits (212), Expect = 1e-17 Identities = 37/52 (71%), Positives = 45/52 (86%) Frame = -2 Query: 281 VFCMTVGPINEAGIGNVPSVIGLLAQQSYNVGYDLVNGFIYFQRIDCELLSG 126 +FCMT+GP + I + PS++GLLAQQSYNVGYDLVN ++YFQRIDCELLSG Sbjct: 394 IFCMTIGPASNIDIKSRPSIVGLLAQQSYNVGYDLVNNYVYFQRIDCELLSG 445 >ref|XP_014522132.1| aspartyl protease UND-like [Vigna radiata var. radiata] Length = 348 Score = 85.5 bits (210), Expect = 1e-17 Identities = 37/52 (71%), Positives = 44/52 (84%) Frame = -2 Query: 281 VFCMTVGPINEAGIGNVPSVIGLLAQQSYNVGYDLVNGFIYFQRIDCELLSG 126 +FCMTVGP + I + PS++GLLAQQ YNVGYDLVN ++YFQRIDCELLSG Sbjct: 297 IFCMTVGPASNIDIKSKPSIVGLLAQQGYNVGYDLVNNYVYFQRIDCELLSG 348 >ref|XP_016198115.1| aspartic proteinase CDR1 [Arachis ipaensis] Length = 462 Score = 85.1 bits (209), Expect = 3e-17 Identities = 38/52 (73%), Positives = 44/52 (84%) Frame = -2 Query: 281 VFCMTVGPINEAGIGNVPSVIGLLAQQSYNVGYDLVNGFIYFQRIDCELLSG 126 VFCM +GP++ G+ N SVIGLLAQQSYNVGYDLVN +YFQRIDC+LLSG Sbjct: 411 VFCMAIGPVSATGLDNRSSVIGLLAQQSYNVGYDLVNQIVYFQRIDCQLLSG 462 >ref|XP_015959995.1| aspartic proteinase CDR1 [Arachis duranensis] Length = 462 Score = 85.1 bits (209), Expect = 3e-17 Identities = 38/52 (73%), Positives = 44/52 (84%) Frame = -2 Query: 281 VFCMTVGPINEAGIGNVPSVIGLLAQQSYNVGYDLVNGFIYFQRIDCELLSG 126 VFCM +GP++ G+ N SVIGLLAQQSYNVGYDLVN +YFQRIDC+LLSG Sbjct: 411 VFCMAIGPVSATGLDNRSSVIGLLAQQSYNVGYDLVNQIVYFQRIDCQLLSG 462 >gb|KYP62289.1| Aspartic proteinase nepenthesin-1 [Cajanus cajan] Length = 387 Score = 84.7 bits (208), Expect = 3e-17 Identities = 39/52 (75%), Positives = 44/52 (84%) Frame = -2 Query: 281 VFCMTVGPINEAGIGNVPSVIGLLAQQSYNVGYDLVNGFIYFQRIDCELLSG 126 VFCMT+GP+N+ + PSVIGLLAQQSYNVGYDL N +YFQRIDCELLSG Sbjct: 336 VFCMTIGPVNDLDNRSKPSVIGLLAQQSYNVGYDLDNHLVYFQRIDCELLSG 387 >ref|XP_020221035.1| aspartic proteinase CDR1-like [Cajanus cajan] Length = 430 Score = 84.7 bits (208), Expect = 4e-17 Identities = 39/52 (75%), Positives = 44/52 (84%) Frame = -2 Query: 281 VFCMTVGPINEAGIGNVPSVIGLLAQQSYNVGYDLVNGFIYFQRIDCELLSG 126 VFCMT+GP+N+ + PSVIGLLAQQSYNVGYDL N +YFQRIDCELLSG Sbjct: 379 VFCMTIGPVNDLDNRSKPSVIGLLAQQSYNVGYDLDNHLVYFQRIDCELLSG 430 >ref|XP_007138783.1| hypothetical protein PHAVU_009G237100g [Phaseolus vulgaris] gb|ESW10777.1| hypothetical protein PHAVU_009G237100g [Phaseolus vulgaris] Length = 446 Score = 84.7 bits (208), Expect = 4e-17 Identities = 37/52 (71%), Positives = 44/52 (84%) Frame = -2 Query: 281 VFCMTVGPINEAGIGNVPSVIGLLAQQSYNVGYDLVNGFIYFQRIDCELLSG 126 +FCMT+GP + I + PSV+GLLAQQSYNVGYDLVN ++Y QRIDCELLSG Sbjct: 395 IFCMTIGPASNIDIKSKPSVVGLLAQQSYNVGYDLVNNYVYLQRIDCELLSG 446 >ref|XP_015935145.1| aspartic proteinase CDR1-like [Arachis duranensis] Length = 421 Score = 82.8 bits (203), Expect = 2e-16 Identities = 36/52 (69%), Positives = 43/52 (82%) Frame = -2 Query: 281 VFCMTVGPINEAGIGNVPSVIGLLAQQSYNVGYDLVNGFIYFQRIDCELLSG 126 VFCM +GP++ G+ N SVIGLLAQQ YNVGYDL+N +YFQRIDC+LLSG Sbjct: 370 VFCMAIGPVSATGVDNRSSVIGLLAQQGYNVGYDLLNQIVYFQRIDCQLLSG 421