BLASTX nr result
ID: Astragalus22_contig00034101
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00034101 (409 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020208044.1| fanconi-associated nuclease 1 homolog isofor... 142 1e-36 gb|KYP32919.1| Coiled-coil domain-containing protein MTMR15 [Caj... 142 1e-36 ref|XP_020208043.1| fanconi-associated nuclease 1 homolog isofor... 142 1e-36 gb|EEF44170.1| conserved hypothetical protein [Ricinus communis] 131 4e-36 ref|XP_007139299.1| hypothetical protein PHAVU_008G017600g [Phas... 140 8e-36 ref|XP_016194622.1| fanconi-associated nuclease 1 homolog [Arach... 140 9e-36 ref|XP_003621733.2| fanconi-associated nuclease-like protein [Me... 139 2e-35 ref|XP_022155223.1| fanconi-associated nuclease 1 homolog isofor... 138 2e-35 dbj|BAT83104.1| hypothetical protein VIGAN_04020600 [Vigna angul... 137 2e-35 gb|KOM36723.1| hypothetical protein LR48_Vigan03g010400 [Vigna a... 137 2e-35 ref|XP_018504055.1| PREDICTED: fanconi-associated nuclease 1 hom... 138 3e-35 ref|XP_009361481.1| PREDICTED: fanconi-associated nuclease 1 hom... 138 3e-35 ref|XP_009361480.1| PREDICTED: fanconi-associated nuclease 1 hom... 138 3e-35 ref|XP_022155222.1| fanconi-associated nuclease 1 homolog isofor... 138 3e-35 gb|PKI48007.1| hypothetical protein CRG98_031600 [Punica granatum] 135 4e-35 gb|KGN52709.1| hypothetical protein Csa_5G651670 [Cucumis sativus] 136 4e-35 dbj|GAU17744.1| hypothetical protein TSUD_171320 [Trifolium subt... 138 4e-35 ref|XP_021614376.1| fanconi-associated nuclease 1 homolog isofor... 138 4e-35 ref|XP_021614375.1| fanconi-associated nuclease 1 homolog isofor... 138 4e-35 ref|XP_021614374.1| fanconi-associated nuclease 1 homolog isofor... 138 4e-35 >ref|XP_020208044.1| fanconi-associated nuclease 1 homolog isoform X2 [Cajanus cajan] Length = 881 Score = 142 bits (359), Expect = 1e-36 Identities = 67/72 (93%), Positives = 68/72 (94%) Frame = -3 Query: 407 ASLCQHLCQDYRSWSSGMPDLLLWRFYGKYSGEAKLVEVKGPRDRLSEQQRAWLLLLMDC 228 AS CQ L QDYRSWSSGMPDLLLWRF+G YSGEAKLVEVKGPRDRLSEQQRAWLLLLMDC Sbjct: 810 ASFCQLLAQDYRSWSSGMPDLLLWRFHGDYSGEAKLVEVKGPRDRLSEQQRAWLLLLMDC 869 Query: 227 GFMIEVCKVKPL 192 GFMIEVCKVKPL Sbjct: 870 GFMIEVCKVKPL 881 >gb|KYP32919.1| Coiled-coil domain-containing protein MTMR15 [Cajanus cajan] Length = 895 Score = 142 bits (359), Expect = 1e-36 Identities = 67/72 (93%), Positives = 68/72 (94%) Frame = -3 Query: 407 ASLCQHLCQDYRSWSSGMPDLLLWRFYGKYSGEAKLVEVKGPRDRLSEQQRAWLLLLMDC 228 AS CQ L QDYRSWSSGMPDLLLWRF+G YSGEAKLVEVKGPRDRLSEQQRAWLLLLMDC Sbjct: 824 ASFCQLLAQDYRSWSSGMPDLLLWRFHGDYSGEAKLVEVKGPRDRLSEQQRAWLLLLMDC 883 Query: 227 GFMIEVCKVKPL 192 GFMIEVCKVKPL Sbjct: 884 GFMIEVCKVKPL 895 >ref|XP_020208043.1| fanconi-associated nuclease 1 homolog isoform X1 [Cajanus cajan] Length = 902 Score = 142 bits (359), Expect = 1e-36 Identities = 67/72 (93%), Positives = 68/72 (94%) Frame = -3 Query: 407 ASLCQHLCQDYRSWSSGMPDLLLWRFYGKYSGEAKLVEVKGPRDRLSEQQRAWLLLLMDC 228 AS CQ L QDYRSWSSGMPDLLLWRF+G YSGEAKLVEVKGPRDRLSEQQRAWLLLLMDC Sbjct: 831 ASFCQLLAQDYRSWSSGMPDLLLWRFHGDYSGEAKLVEVKGPRDRLSEQQRAWLLLLMDC 890 Query: 227 GFMIEVCKVKPL 192 GFMIEVCKVKPL Sbjct: 891 GFMIEVCKVKPL 902 >gb|EEF44170.1| conserved hypothetical protein [Ricinus communis] Length = 188 Score = 131 bits (330), Expect = 4e-36 Identities = 59/72 (81%), Positives = 65/72 (90%) Frame = -3 Query: 407 ASLCQHLCQDYRSWSSGMPDLLLWRFYGKYSGEAKLVEVKGPRDRLSEQQRAWLLLLMDC 228 ASLC+HL QDYRSWSSGMPDL LWRF G+Y GEAKLVEVKGP+D LSEQQ+AWLLLLMDC Sbjct: 113 ASLCRHLSQDYRSWSSGMPDLFLWRFQGEYRGEAKLVEVKGPKDSLSEQQQAWLLLLMDC 172 Query: 227 GFMIEVCKVKPL 192 GF EVCKV+P+ Sbjct: 173 GFSTEVCKVRPM 184 >ref|XP_007139299.1| hypothetical protein PHAVU_008G017600g [Phaseolus vulgaris] gb|ESW11293.1| hypothetical protein PHAVU_008G017600g [Phaseolus vulgaris] Length = 920 Score = 140 bits (352), Expect = 8e-36 Identities = 65/72 (90%), Positives = 68/72 (94%) Frame = -3 Query: 407 ASLCQHLCQDYRSWSSGMPDLLLWRFYGKYSGEAKLVEVKGPRDRLSEQQRAWLLLLMDC 228 ASLCQ L QDYRSWSSGMPDLLLWRF+G+YSGEAKLVEVKGP DRLSEQQRAWLLLLMDC Sbjct: 849 ASLCQLLAQDYRSWSSGMPDLLLWRFHGEYSGEAKLVEVKGPSDRLSEQQRAWLLLLMDC 908 Query: 227 GFMIEVCKVKPL 192 GF +EVCKVKPL Sbjct: 909 GFAVEVCKVKPL 920 >ref|XP_016194622.1| fanconi-associated nuclease 1 homolog [Arachis ipaensis] Length = 932 Score = 140 bits (352), Expect = 9e-36 Identities = 65/72 (90%), Positives = 69/72 (95%) Frame = -3 Query: 407 ASLCQHLCQDYRSWSSGMPDLLLWRFYGKYSGEAKLVEVKGPRDRLSEQQRAWLLLLMDC 228 ASLC+ L QDYRSWSSGMPDLLLWRF G+YSGEAKLVEVKGPRDRLSEQQRAWLLLLMDC Sbjct: 861 ASLCELLTQDYRSWSSGMPDLLLWRFNGEYSGEAKLVEVKGPRDRLSEQQRAWLLLLMDC 920 Query: 227 GFMIEVCKVKPL 192 GF++EVCKVKPL Sbjct: 921 GFVVEVCKVKPL 932 >ref|XP_003621733.2| fanconi-associated nuclease-like protein [Medicago truncatula] gb|AES77951.2| fanconi-associated nuclease-like protein [Medicago truncatula] Length = 909 Score = 139 bits (350), Expect = 2e-35 Identities = 63/72 (87%), Positives = 68/72 (94%) Frame = -3 Query: 407 ASLCQHLCQDYRSWSSGMPDLLLWRFYGKYSGEAKLVEVKGPRDRLSEQQRAWLLLLMDC 228 AS C LC+DYRSWSSGMPDLLLWRF G+YSGEAKLVEVKGP+DRLSEQQRAWLL+LMDC Sbjct: 838 ASFCLLLCEDYRSWSSGMPDLLLWRFCGEYSGEAKLVEVKGPKDRLSEQQRAWLLMLMDC 897 Query: 227 GFMIEVCKVKPL 192 GFM+EVCKVKPL Sbjct: 898 GFMVEVCKVKPL 909 >ref|XP_022155223.1| fanconi-associated nuclease 1 homolog isoform X2 [Momordica charantia] Length = 684 Score = 138 bits (348), Expect = 2e-35 Identities = 62/72 (86%), Positives = 68/72 (94%) Frame = -3 Query: 407 ASLCQHLCQDYRSWSSGMPDLLLWRFYGKYSGEAKLVEVKGPRDRLSEQQRAWLLLLMDC 228 ASLC+HL QDYRSWSSGMPDLLLWRF+G+YSGEAKLVEVKGPRDRLSEQQRAWLLLLM+C Sbjct: 609 ASLCRHLAQDYRSWSSGMPDLLLWRFHGEYSGEAKLVEVKGPRDRLSEQQRAWLLLLMEC 668 Query: 227 GFMIEVCKVKPL 192 GF EVCK+ P+ Sbjct: 669 GFKTEVCKITPI 680 >dbj|BAT83104.1| hypothetical protein VIGAN_04020600 [Vigna angularis var. angularis] Length = 513 Score = 137 bits (344), Expect = 2e-35 Identities = 64/72 (88%), Positives = 67/72 (93%) Frame = -3 Query: 407 ASLCQHLCQDYRSWSSGMPDLLLWRFYGKYSGEAKLVEVKGPRDRLSEQQRAWLLLLMDC 228 ASLCQ L QDYRSWSSGMPDLLLWRF+G+YSGEAKLVEVKG DRLSEQQRAWLLLLMDC Sbjct: 442 ASLCQLLAQDYRSWSSGMPDLLLWRFHGEYSGEAKLVEVKGHNDRLSEQQRAWLLLLMDC 501 Query: 227 GFMIEVCKVKPL 192 GF +EVCKVKPL Sbjct: 502 GFSVEVCKVKPL 513 >gb|KOM36723.1| hypothetical protein LR48_Vigan03g010400 [Vigna angularis] Length = 513 Score = 137 bits (344), Expect = 2e-35 Identities = 64/72 (88%), Positives = 67/72 (93%) Frame = -3 Query: 407 ASLCQHLCQDYRSWSSGMPDLLLWRFYGKYSGEAKLVEVKGPRDRLSEQQRAWLLLLMDC 228 ASLCQ L QDYRSWSSGMPDLLLWRF+G+YSGEAKLVEVKG DRLSEQQRAWLLLLMDC Sbjct: 442 ASLCQLLAQDYRSWSSGMPDLLLWRFHGEYSGEAKLVEVKGHNDRLSEQQRAWLLLLMDC 501 Query: 227 GFMIEVCKVKPL 192 GF +EVCKVKPL Sbjct: 502 GFSVEVCKVKPL 513 >ref|XP_018504055.1| PREDICTED: fanconi-associated nuclease 1 homolog isoform X3 [Pyrus x bretschneideri] ref|XP_018507763.1| PREDICTED: fanconi-associated nuclease 1 homolog isoform X3 [Pyrus x bretschneideri] ref|XP_018507765.1| PREDICTED: fanconi-associated nuclease 1 homolog isoform X3 [Pyrus x bretschneideri] Length = 843 Score = 138 bits (348), Expect = 3e-35 Identities = 63/72 (87%), Positives = 66/72 (91%) Frame = -3 Query: 407 ASLCQHLCQDYRSWSSGMPDLLLWRFYGKYSGEAKLVEVKGPRDRLSEQQRAWLLLLMDC 228 AS C+HL QDYRSWSSGMPDLLLWRF+GKY GEAKLVEVKGPRDRLSEQQRAWLLLLMDC Sbjct: 771 ASFCRHLAQDYRSWSSGMPDLLLWRFHGKYKGEAKLVEVKGPRDRLSEQQRAWLLLLMDC 830 Query: 227 GFMIEVCKVKPL 192 GF EVCKV P+ Sbjct: 831 GFNAEVCKVNPV 842 >ref|XP_009361481.1| PREDICTED: fanconi-associated nuclease 1 homolog isoform X2 [Pyrus x bretschneideri] ref|XP_009378171.1| PREDICTED: fanconi-associated nuclease 1 homolog isoform X2 [Pyrus x bretschneideri] ref|XP_018507762.1| PREDICTED: fanconi-associated nuclease 1 homolog isoform X2 [Pyrus x bretschneideri] Length = 910 Score = 138 bits (348), Expect = 3e-35 Identities = 63/72 (87%), Positives = 66/72 (91%) Frame = -3 Query: 407 ASLCQHLCQDYRSWSSGMPDLLLWRFYGKYSGEAKLVEVKGPRDRLSEQQRAWLLLLMDC 228 AS C+HL QDYRSWSSGMPDLLLWRF+GKY GEAKLVEVKGPRDRLSEQQRAWLLLLMDC Sbjct: 838 ASFCRHLAQDYRSWSSGMPDLLLWRFHGKYKGEAKLVEVKGPRDRLSEQQRAWLLLLMDC 897 Query: 227 GFMIEVCKVKPL 192 GF EVCKV P+ Sbjct: 898 GFNAEVCKVNPV 909 >ref|XP_009361480.1| PREDICTED: fanconi-associated nuclease 1 homolog isoform X1 [Pyrus x bretschneideri] ref|XP_009378169.1| PREDICTED: fanconi-associated nuclease 1 homolog isoform X1 [Pyrus x bretschneideri] ref|XP_009378170.1| PREDICTED: fanconi-associated nuclease 1 homolog isoform X1 [Pyrus x bretschneideri] Length = 936 Score = 138 bits (348), Expect = 3e-35 Identities = 63/72 (87%), Positives = 66/72 (91%) Frame = -3 Query: 407 ASLCQHLCQDYRSWSSGMPDLLLWRFYGKYSGEAKLVEVKGPRDRLSEQQRAWLLLLMDC 228 AS C+HL QDYRSWSSGMPDLLLWRF+GKY GEAKLVEVKGPRDRLSEQQRAWLLLLMDC Sbjct: 864 ASFCRHLAQDYRSWSSGMPDLLLWRFHGKYKGEAKLVEVKGPRDRLSEQQRAWLLLLMDC 923 Query: 227 GFMIEVCKVKPL 192 GF EVCKV P+ Sbjct: 924 GFNAEVCKVNPV 935 >ref|XP_022155222.1| fanconi-associated nuclease 1 homolog isoform X1 [Momordica charantia] Length = 947 Score = 138 bits (348), Expect = 3e-35 Identities = 62/72 (86%), Positives = 68/72 (94%) Frame = -3 Query: 407 ASLCQHLCQDYRSWSSGMPDLLLWRFYGKYSGEAKLVEVKGPRDRLSEQQRAWLLLLMDC 228 ASLC+HL QDYRSWSSGMPDLLLWRF+G+YSGEAKLVEVKGPRDRLSEQQRAWLLLLM+C Sbjct: 872 ASLCRHLAQDYRSWSSGMPDLLLWRFHGEYSGEAKLVEVKGPRDRLSEQQRAWLLLLMEC 931 Query: 227 GFMIEVCKVKPL 192 GF EVCK+ P+ Sbjct: 932 GFKTEVCKITPI 943 >gb|PKI48007.1| hypothetical protein CRG98_031600 [Punica granatum] Length = 472 Score = 135 bits (341), Expect = 4e-35 Identities = 62/71 (87%), Positives = 66/71 (92%) Frame = -3 Query: 407 ASLCQHLCQDYRSWSSGMPDLLLWRFYGKYSGEAKLVEVKGPRDRLSEQQRAWLLLLMDC 228 ASLCQ+LCQDYRSWSSGMPDLLLWRF+G+Y GEAKLVEVKGP DRLSEQQRAWLLLLMD Sbjct: 397 ASLCQNLCQDYRSWSSGMPDLLLWRFHGEYKGEAKLVEVKGPTDRLSEQQRAWLLLLMDM 456 Query: 227 GFMIEVCKVKP 195 GF +EVCKV P Sbjct: 457 GFNVEVCKVSP 467 >gb|KGN52709.1| hypothetical protein Csa_5G651670 [Cucumis sativus] Length = 502 Score = 136 bits (342), Expect = 4e-35 Identities = 61/71 (85%), Positives = 67/71 (94%) Frame = -3 Query: 407 ASLCQHLCQDYRSWSSGMPDLLLWRFYGKYSGEAKLVEVKGPRDRLSEQQRAWLLLLMDC 228 ASLC+HL QDYRSWSSGMPDLLLWRF +YSGEAKLVEVKGP+DRLSEQQRAW+LLLMDC Sbjct: 431 ASLCRHLAQDYRSWSSGMPDLLLWRFNSEYSGEAKLVEVKGPKDRLSEQQRAWILLLMDC 490 Query: 227 GFMIEVCKVKP 195 GF+IEVCK+ P Sbjct: 491 GFIIEVCKITP 501 >dbj|GAU17744.1| hypothetical protein TSUD_171320 [Trifolium subterraneum] Length = 911 Score = 138 bits (347), Expect = 4e-35 Identities = 63/71 (88%), Positives = 67/71 (94%) Frame = -3 Query: 404 SLCQHLCQDYRSWSSGMPDLLLWRFYGKYSGEAKLVEVKGPRDRLSEQQRAWLLLLMDCG 225 S C+ LC+DYRSWSSGMPDLLLWRF G+YSGEAKLVEVKGPRDRLSEQQRAWLL+LMDCG Sbjct: 841 SFCKLLCEDYRSWSSGMPDLLLWRFCGEYSGEAKLVEVKGPRDRLSEQQRAWLLMLMDCG 900 Query: 224 FMIEVCKVKPL 192 F IEVCKVKPL Sbjct: 901 FTIEVCKVKPL 911 >ref|XP_021614376.1| fanconi-associated nuclease 1 homolog isoform X4 [Manihot esculenta] gb|OAY51183.1| hypothetical protein MANES_05G194700 [Manihot esculenta] Length = 933 Score = 138 bits (347), Expect = 4e-35 Identities = 63/72 (87%), Positives = 68/72 (94%) Frame = -3 Query: 407 ASLCQHLCQDYRSWSSGMPDLLLWRFYGKYSGEAKLVEVKGPRDRLSEQQRAWLLLLMDC 228 ASLC+HL QDYRSWSSGMPDLLLWRF+G+Y GEAKLVEVKGP+DRLSEQQ+AWLLLLMDC Sbjct: 858 ASLCRHLAQDYRSWSSGMPDLLLWRFHGEYRGEAKLVEVKGPKDRLSEQQQAWLLLLMDC 917 Query: 227 GFMIEVCKVKPL 192 GF EVCKVKPL Sbjct: 918 GFDTEVCKVKPL 929 >ref|XP_021614375.1| fanconi-associated nuclease 1 homolog isoform X3 [Manihot esculenta] Length = 940 Score = 138 bits (347), Expect = 4e-35 Identities = 63/72 (87%), Positives = 68/72 (94%) Frame = -3 Query: 407 ASLCQHLCQDYRSWSSGMPDLLLWRFYGKYSGEAKLVEVKGPRDRLSEQQRAWLLLLMDC 228 ASLC+HL QDYRSWSSGMPDLLLWRF+G+Y GEAKLVEVKGP+DRLSEQQ+AWLLLLMDC Sbjct: 865 ASLCRHLAQDYRSWSSGMPDLLLWRFHGEYRGEAKLVEVKGPKDRLSEQQQAWLLLLMDC 924 Query: 227 GFMIEVCKVKPL 192 GF EVCKVKPL Sbjct: 925 GFDTEVCKVKPL 936 >ref|XP_021614374.1| fanconi-associated nuclease 1 homolog isoform X2 [Manihot esculenta] Length = 942 Score = 138 bits (347), Expect = 4e-35 Identities = 63/72 (87%), Positives = 68/72 (94%) Frame = -3 Query: 407 ASLCQHLCQDYRSWSSGMPDLLLWRFYGKYSGEAKLVEVKGPRDRLSEQQRAWLLLLMDC 228 ASLC+HL QDYRSWSSGMPDLLLWRF+G+Y GEAKLVEVKGP+DRLSEQQ+AWLLLLMDC Sbjct: 867 ASLCRHLAQDYRSWSSGMPDLLLWRFHGEYRGEAKLVEVKGPKDRLSEQQQAWLLLLMDC 926 Query: 227 GFMIEVCKVKPL 192 GF EVCKVKPL Sbjct: 927 GFDTEVCKVKPL 938