BLASTX nr result
ID: Astragalus22_contig00033972
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00033972 (463 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH77953.1| hypothetical protein GLYMA_01G244000 [Glycine max] 56 1e-07 gb|KHN42349.1| hypothetical protein glysoja_020061 [Glycine soja... 54 9e-07 >gb|KRH77953.1| hypothetical protein GLYMA_01G244000 [Glycine max] Length = 59 Score = 55.8 bits (133), Expect = 1e-07 Identities = 27/40 (67%), Positives = 33/40 (82%) Frame = +3 Query: 111 MKVEGIRPLPLPLPDQSAPSFITLIINRAYSGPSHKGRGH 230 +KVEG+RPL ++ PSFI+LIINRAYSGPSH+GRGH Sbjct: 26 IKVEGMRPL------KADPSFISLIINRAYSGPSHRGRGH 59 >gb|KHN42349.1| hypothetical protein glysoja_020061 [Glycine soja] gb|KRG91041.1| hypothetical protein GLYMA_20G130100 [Glycine max] Length = 63 Score = 53.5 bits (127), Expect = 9e-07 Identities = 33/65 (50%), Positives = 36/65 (55%) Frame = +3 Query: 36 GYSLAVAFNAXXXXXXXXXXXXXXXMKVEGIRPLPLPLPDQSAPSFITLIINRAYSGPSH 215 GYSLAVAFNA VE R L S+P+FI LIINRAYSGPSH Sbjct: 3 GYSLAVAFNAIFLVIFLLLLLSYSN-NVESTRTLK---DQSSSPAFIGLIINRAYSGPSH 58 Query: 216 KGRGH 230 +G GH Sbjct: 59 RGAGH 63