BLASTX nr result
ID: Astragalus22_contig00033967
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00033967 (440 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014523892.2| pentatricopeptide repeat-containing protein ... 140 7e-36 ref|XP_007146505.1| hypothetical protein PHAVU_006G046500g [Phas... 139 2e-35 dbj|BAT88613.1| hypothetical protein VIGAN_05215200 [Vigna angul... 139 2e-35 ref|XP_017409348.1| PREDICTED: pentatricopeptide repeat-containi... 139 2e-35 ref|XP_007146506.1| hypothetical protein PHAVU_006G046500g [Phas... 139 2e-35 gb|KHN18078.1| Pentatricopeptide repeat-containing protein [Glyc... 131 3e-35 gb|KRG98716.1| hypothetical protein GLYMA_18G093100 [Glycine max] 133 2e-33 gb|KRG98715.1| hypothetical protein GLYMA_18G093100 [Glycine max] 133 3e-33 ref|XP_003553062.1| PREDICTED: pentatricopeptide repeat-containi... 133 3e-33 ref|XP_020230545.1| pentatricopeptide repeat-containing protein ... 132 9e-33 gb|KHN12515.1| Pentatricopeptide repeat-containing protein [Glyc... 131 2e-32 gb|KRG98935.1| hypothetical protein GLYMA_18G108200 [Glycine max] 129 1e-31 gb|PNY15172.1| pentatricopeptide repeat-containing protein at5g1... 128 1e-31 dbj|GAU20446.1| hypothetical protein TSUD_130040 [Trifolium subt... 128 2e-31 ref|XP_013459832.1| PPR containing plant-like protein [Medicago ... 127 5e-31 ref|XP_004500100.1| PREDICTED: pentatricopeptide repeat-containi... 121 5e-29 ref|XP_019440684.1| PREDICTED: pentatricopeptide repeat-containi... 115 4e-27 ref|XP_015958667.1| pentatricopeptide repeat-containing protein ... 115 8e-27 ref|XP_016182918.1| pentatricopeptide repeat-containing protein ... 114 1e-26 ref|XP_011035789.1| PREDICTED: pentatricopeptide repeat-containi... 101 5e-22 >ref|XP_014523892.2| pentatricopeptide repeat-containing protein At5g15280, mitochondrial [Vigna radiata var. radiata] Length = 1077 Score = 140 bits (354), Expect = 7e-36 Identities = 67/77 (87%), Positives = 72/77 (93%) Frame = +1 Query: 1 PTRNMYCTVVKSYYIEKNMRKASELMQAMQEKGYQPDFEIHWSLISNLSSVKAKDTDIGS 180 PTR MYCTV+KSY++EKN+RKASELMQAMQE GYQPDFE HWSLISNL+SVKAKDTD G Sbjct: 1001 PTRKMYCTVIKSYHMEKNLRKASELMQAMQENGYQPDFETHWSLISNLNSVKAKDTDNGG 1060 Query: 181 KGFLSRLLSKSGFLQKK 231 KGFLSRLLSKSGFLQKK Sbjct: 1061 KGFLSRLLSKSGFLQKK 1077 >ref|XP_007146505.1| hypothetical protein PHAVU_006G046500g [Phaseolus vulgaris] gb|ESW18499.1| hypothetical protein PHAVU_006G046500g [Phaseolus vulgaris] Length = 859 Score = 139 bits (350), Expect = 2e-35 Identities = 66/77 (85%), Positives = 71/77 (92%) Frame = +1 Query: 1 PTRNMYCTVVKSYYIEKNMRKASELMQAMQEKGYQPDFEIHWSLISNLSSVKAKDTDIGS 180 PTR MYCTV+KSY++EKN+RKASELMQAMQE GYQPDFE HWSLISNL+S KAKDTD G Sbjct: 783 PTRKMYCTVIKSYHMEKNLRKASELMQAMQENGYQPDFETHWSLISNLNSAKAKDTDNGG 842 Query: 181 KGFLSRLLSKSGFLQKK 231 KGFLSRLLSKSGFLQKK Sbjct: 843 KGFLSRLLSKSGFLQKK 859 >dbj|BAT88613.1| hypothetical protein VIGAN_05215200 [Vigna angularis var. angularis] Length = 1189 Score = 139 bits (350), Expect = 2e-35 Identities = 66/77 (85%), Positives = 71/77 (92%) Frame = +1 Query: 1 PTRNMYCTVVKSYYIEKNMRKASELMQAMQEKGYQPDFEIHWSLISNLSSVKAKDTDIGS 180 PTR MYCTV+KSY++EKN+RKASELMQAMQE GYQPDFE HWSLISNL+S KAKDTD G Sbjct: 1113 PTRKMYCTVIKSYHMEKNLRKASELMQAMQENGYQPDFETHWSLISNLNSTKAKDTDNGG 1172 Query: 181 KGFLSRLLSKSGFLQKK 231 KGFLSRLLSKSGFLQKK Sbjct: 1173 KGFLSRLLSKSGFLQKK 1189 >ref|XP_017409348.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280 [Vigna angularis] gb|KOM28779.1| hypothetical protein LR48_Vigan583s003000 [Vigna angularis] Length = 1189 Score = 139 bits (350), Expect = 2e-35 Identities = 66/77 (85%), Positives = 71/77 (92%) Frame = +1 Query: 1 PTRNMYCTVVKSYYIEKNMRKASELMQAMQEKGYQPDFEIHWSLISNLSSVKAKDTDIGS 180 PTR MYCTV+KSY++EKN+RKASELMQAMQE GYQPDFE HWSLISNL+S KAKDTD G Sbjct: 1113 PTRKMYCTVIKSYHMEKNLRKASELMQAMQENGYQPDFETHWSLISNLNSTKAKDTDNGG 1172 Query: 181 KGFLSRLLSKSGFLQKK 231 KGFLSRLLSKSGFLQKK Sbjct: 1173 KGFLSRLLSKSGFLQKK 1189 >ref|XP_007146506.1| hypothetical protein PHAVU_006G046500g [Phaseolus vulgaris] gb|ESW18500.1| hypothetical protein PHAVU_006G046500g [Phaseolus vulgaris] Length = 1189 Score = 139 bits (350), Expect = 2e-35 Identities = 66/77 (85%), Positives = 71/77 (92%) Frame = +1 Query: 1 PTRNMYCTVVKSYYIEKNMRKASELMQAMQEKGYQPDFEIHWSLISNLSSVKAKDTDIGS 180 PTR MYCTV+KSY++EKN+RKASELMQAMQE GYQPDFE HWSLISNL+S KAKDTD G Sbjct: 1113 PTRKMYCTVIKSYHMEKNLRKASELMQAMQENGYQPDFETHWSLISNLNSAKAKDTDNGG 1172 Query: 181 KGFLSRLLSKSGFLQKK 231 KGFLSRLLSKSGFLQKK Sbjct: 1173 KGFLSRLLSKSGFLQKK 1189 >gb|KHN18078.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 235 Score = 131 bits (329), Expect = 3e-35 Identities = 62/77 (80%), Positives = 69/77 (89%) Frame = +1 Query: 1 PTRNMYCTVVKSYYIEKNMRKASELMQAMQEKGYQPDFEIHWSLISNLSSVKAKDTDIGS 180 PTR MYCTV+KSY+++KN+RKASEL+QAMQE GYQPDFE HWSLISNL+S KAKDTD S Sbjct: 159 PTRKMYCTVIKSYHMKKNLRKASELLQAMQENGYQPDFETHWSLISNLNSAKAKDTDNAS 218 Query: 181 KGFLSRLLSKSGFLQKK 231 GFLSRLL KSGFLQKK Sbjct: 219 TGFLSRLLFKSGFLQKK 235 >gb|KRG98716.1| hypothetical protein GLYMA_18G093100 [Glycine max] Length = 859 Score = 133 bits (335), Expect = 2e-33 Identities = 63/77 (81%), Positives = 70/77 (90%) Frame = +1 Query: 1 PTRNMYCTVVKSYYIEKNMRKASELMQAMQEKGYQPDFEIHWSLISNLSSVKAKDTDIGS 180 PTR MYCTV+KSY+++KN+RKASEL+QAMQE GYQPDFE HWSLISNL+S KAKDTD S Sbjct: 783 PTRKMYCTVIKSYHMKKNLRKASELLQAMQENGYQPDFETHWSLISNLNSAKAKDTDNAS 842 Query: 181 KGFLSRLLSKSGFLQKK 231 KGFLSRLL KSGFLQKK Sbjct: 843 KGFLSRLLFKSGFLQKK 859 >gb|KRG98715.1| hypothetical protein GLYMA_18G093100 [Glycine max] Length = 1168 Score = 133 bits (335), Expect = 3e-33 Identities = 63/77 (81%), Positives = 70/77 (90%) Frame = +1 Query: 1 PTRNMYCTVVKSYYIEKNMRKASELMQAMQEKGYQPDFEIHWSLISNLSSVKAKDTDIGS 180 PTR MYCTV+KSY+++KN+RKASEL+QAMQE GYQPDFE HWSLISNL+S KAKDTD S Sbjct: 1092 PTRKMYCTVIKSYHMKKNLRKASELLQAMQENGYQPDFETHWSLISNLNSAKAKDTDNAS 1151 Query: 181 KGFLSRLLSKSGFLQKK 231 KGFLSRLL KSGFLQKK Sbjct: 1152 KGFLSRLLFKSGFLQKK 1168 >ref|XP_003553062.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280-like [Glycine max] Length = 1186 Score = 133 bits (335), Expect = 3e-33 Identities = 63/77 (81%), Positives = 70/77 (90%) Frame = +1 Query: 1 PTRNMYCTVVKSYYIEKNMRKASELMQAMQEKGYQPDFEIHWSLISNLSSVKAKDTDIGS 180 PTR MYCTV+KSY+++KN+RKASEL+QAMQE GYQPDFE HWSLISNL+S KAKDTD S Sbjct: 1110 PTRKMYCTVIKSYHMKKNLRKASELLQAMQENGYQPDFETHWSLISNLNSAKAKDTDNAS 1169 Query: 181 KGFLSRLLSKSGFLQKK 231 KGFLSRLL KSGFLQKK Sbjct: 1170 KGFLSRLLFKSGFLQKK 1186 >ref|XP_020230545.1| pentatricopeptide repeat-containing protein At5g15280 [Cajanus cajan] gb|KYP52192.1| Pentatricopeptide repeat-containing protein At5g15280 family [Cajanus cajan] Length = 1181 Score = 132 bits (331), Expect = 9e-33 Identities = 62/77 (80%), Positives = 71/77 (92%) Frame = +1 Query: 1 PTRNMYCTVVKSYYIEKNMRKASELMQAMQEKGYQPDFEIHWSLISNLSSVKAKDTDIGS 180 P+R MYCTV+KSY++EKN+RKASELMQAMQE G+QPDFEIHWSLISNL+S KAKDT G+ Sbjct: 1105 PSRKMYCTVIKSYHMEKNLRKASELMQAMQESGFQPDFEIHWSLISNLNSAKAKDTAKGT 1164 Query: 181 KGFLSRLLSKSGFLQKK 231 KGFLS LLS+SGFLQKK Sbjct: 1165 KGFLSSLLSRSGFLQKK 1181 >gb|KHN12515.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 993 Score = 131 bits (329), Expect = 2e-32 Identities = 62/77 (80%), Positives = 69/77 (89%) Frame = +1 Query: 1 PTRNMYCTVVKSYYIEKNMRKASELMQAMQEKGYQPDFEIHWSLISNLSSVKAKDTDIGS 180 PTR MYCTV+KSY+++KN+RKASEL+QAMQE GYQPDFE HWSLISNL+S KAKDTD S Sbjct: 917 PTRKMYCTVIKSYHMKKNLRKASELLQAMQENGYQPDFETHWSLISNLNSAKAKDTDNAS 976 Query: 181 KGFLSRLLSKSGFLQKK 231 GFLSRLL KSGFLQKK Sbjct: 977 TGFLSRLLFKSGFLQKK 993 >gb|KRG98935.1| hypothetical protein GLYMA_18G108200 [Glycine max] Length = 1094 Score = 129 bits (323), Expect = 1e-31 Identities = 61/77 (79%), Positives = 68/77 (88%) Frame = +1 Query: 1 PTRNMYCTVVKSYYIEKNMRKASELMQAMQEKGYQPDFEIHWSLISNLSSVKAKDTDIGS 180 PTR MYC V+KSY+++KN+RKASEL+QAMQE GYQPDFE HWSLISNL+S KAKDTD S Sbjct: 1018 PTRKMYCPVIKSYHMKKNLRKASELLQAMQENGYQPDFETHWSLISNLNSAKAKDTDNAS 1077 Query: 181 KGFLSRLLSKSGFLQKK 231 GFLSRLL KSGFLQKK Sbjct: 1078 TGFLSRLLFKSGFLQKK 1094 >gb|PNY15172.1| pentatricopeptide repeat-containing protein at5g15280-like protein [Trifolium pratense] Length = 1084 Score = 128 bits (322), Expect = 1e-31 Identities = 61/78 (78%), Positives = 71/78 (91%), Gaps = 1/78 (1%) Frame = +1 Query: 1 PTRNMYCTVVKSYYIEKNMRKASELMQAMQEKGYQPDFEIHWSLISNLSSVKAKD-TDIG 177 PTR MYCTV+KSY+ E N+RKASEL+QAMQEKGYQPDF+IHWSL+SNLS+ K KD TD G Sbjct: 1007 PTRKMYCTVIKSYHTENNLRKASELVQAMQEKGYQPDFDIHWSLVSNLSNAKEKDTTDNG 1066 Query: 178 SKGFLSRLLSKSGFLQKK 231 SKGFLSRLLSK+GFL+K+ Sbjct: 1067 SKGFLSRLLSKTGFLRKR 1084 >dbj|GAU20446.1| hypothetical protein TSUD_130040 [Trifolium subterraneum] Length = 780 Score = 128 bits (321), Expect = 2e-31 Identities = 62/78 (79%), Positives = 70/78 (89%), Gaps = 1/78 (1%) Frame = +1 Query: 1 PTRNMYCTVVKSYYIEKNMRKASELMQAMQEKGYQPDFEIHWSLISNLSSVKAKD-TDIG 177 PTR MYCTV+KSY+ E N+RKASEL+QAMQEKGYQPDF+IHWSLISNLS+ K KD TD Sbjct: 703 PTRKMYCTVIKSYHTENNLRKASELVQAMQEKGYQPDFDIHWSLISNLSNAKEKDTTDNS 762 Query: 178 SKGFLSRLLSKSGFLQKK 231 SKGFLSRLLSK+GFLQK+ Sbjct: 763 SKGFLSRLLSKTGFLQKR 780 >ref|XP_013459832.1| PPR containing plant-like protein [Medicago truncatula] gb|KEH33863.1| PPR containing plant-like protein [Medicago truncatula] Length = 1200 Score = 127 bits (318), Expect = 5e-31 Identities = 59/76 (77%), Positives = 70/76 (92%) Frame = +1 Query: 1 PTRNMYCTVVKSYYIEKNMRKASELMQAMQEKGYQPDFEIHWSLISNLSSVKAKDTDIGS 180 PTR MY TV+KSY++EKN++KAS L+QAMQEKGYQPDF+IHWSLISNLS+ K KDTD G+ Sbjct: 1122 PTRKMYSTVIKSYHMEKNLKKASYLVQAMQEKGYQPDFDIHWSLISNLSNAKEKDTDNGN 1181 Query: 181 KGFLSRLLSKSGFLQK 228 KGFLSRLLSK+GFLQ+ Sbjct: 1182 KGFLSRLLSKTGFLQR 1197 >ref|XP_004500100.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280 [Cicer arietinum] Length = 1191 Score = 121 bits (303), Expect = 5e-29 Identities = 62/80 (77%), Positives = 70/80 (87%), Gaps = 3/80 (3%) Frame = +1 Query: 1 PTRNMYCTVVKSYYIEK-NMRKASELMQAMQEKGYQPDFEIHWSLISNLSSVKAKDTDI- 174 PTR MYCTV+KSY++EK N+RKASELMQAMQEKGYQPDFEIHWS ISNLS+ K K TD Sbjct: 1112 PTRKMYCTVIKSYHMEKKNLRKASELMQAMQEKGYQPDFEIHWSHISNLSNAKEKVTDNN 1171 Query: 175 -GSKGFLSRLLSKSGFLQKK 231 +KGFLSRLLSK+GFLQK+ Sbjct: 1172 GSNKGFLSRLLSKTGFLQKR 1191 >ref|XP_019440684.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280 [Lupinus angustifolius] gb|OIW13424.1| hypothetical protein TanjilG_33073 [Lupinus angustifolius] Length = 1259 Score = 115 bits (289), Expect = 4e-27 Identities = 55/77 (71%), Positives = 66/77 (85%) Frame = +1 Query: 1 PTRNMYCTVVKSYYIEKNMRKASELMQAMQEKGYQPDFEIHWSLISNLSSVKAKDTDIGS 180 PT+ MY T+++SY++EKN+ K SEL+Q M + GYQPDFE HWSLISNLS+ KAKDT+ GS Sbjct: 1183 PTQIMYSTIIRSYHMEKNLNKVSELLQDMLKFGYQPDFETHWSLISNLSNCKAKDTENGS 1242 Query: 181 KGFLSRLLSKSGFLQKK 231 KGFLSRLLSKSGFL KK Sbjct: 1243 KGFLSRLLSKSGFLLKK 1259 >ref|XP_015958667.1| pentatricopeptide repeat-containing protein At5g15280 [Arachis duranensis] Length = 1234 Score = 115 bits (287), Expect = 8e-27 Identities = 58/77 (75%), Positives = 66/77 (85%) Frame = +1 Query: 1 PTRNMYCTVVKSYYIEKNMRKASELMQAMQEKGYQPDFEIHWSLISNLSSVKAKDTDIGS 180 PTR MY V+KSY EKN+ KAS LMQAMQ+ GY+PDFE HWSLISNLS+VKAKD+D S Sbjct: 1159 PTREMYGAVIKSYRNEKNLGKASYLMQAMQDSGYEPDFETHWSLISNLSNVKAKDSD-NS 1217 Query: 181 KGFLSRLLSKSGFLQKK 231 +GFLSRLLSKSGFL+KK Sbjct: 1218 RGFLSRLLSKSGFLKKK 1234 >ref|XP_016182918.1| pentatricopeptide repeat-containing protein At5g15280 [Arachis ipaensis] Length = 1234 Score = 114 bits (285), Expect = 1e-26 Identities = 58/77 (75%), Positives = 66/77 (85%) Frame = +1 Query: 1 PTRNMYCTVVKSYYIEKNMRKASELMQAMQEKGYQPDFEIHWSLISNLSSVKAKDTDIGS 180 PTR MY V+KSY EKN+ KAS LMQAMQ+ GY+PDFE HWSLISNLS+VKAKD+D S Sbjct: 1159 PTREMYGAVIKSYRKEKNLGKASYLMQAMQDSGYEPDFETHWSLISNLSNVKAKDSD-HS 1217 Query: 181 KGFLSRLLSKSGFLQKK 231 +GFLSRLLSKSGFL+KK Sbjct: 1218 RGFLSRLLSKSGFLKKK 1234 >ref|XP_011035789.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280 [Populus euphratica] Length = 1255 Score = 101 bits (251), Expect = 5e-22 Identities = 49/80 (61%), Positives = 59/80 (73%) Frame = +1 Query: 1 PTRNMYCTVVKSYYIEKNMRKASELMQAMQEKGYQPDFEIHWSLISNLSSVKAKDTDIGS 180 PTR MYC+V+ Y +E N RKASELMQ MQ+ GY+PDFE HWSLISNLS+ KD + S Sbjct: 1172 PTRLMYCSVIDGYRLENNPRKASELMQMMQQSGYEPDFETHWSLISNLSNSSDKDYNRSS 1231 Query: 181 KGFLSRLLSKSGFLQKK*MK 240 +GFLS LL+ GF KK +K Sbjct: 1232 QGFLSSLLAGGGFSSKKDLK 1251