BLASTX nr result
ID: Astragalus22_contig00033803
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00033803 (836 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003612524.2| bystin, putative [Medicago truncatula] >gi|6... 64 1e-07 ref|XP_017246132.1| PREDICTED: bystin-like [Daucus carota subsp.... 58 8e-06 >ref|XP_003612524.2| bystin, putative [Medicago truncatula] gb|AES95482.2| bystin, putative [Medicago truncatula] Length = 448 Score = 63.5 bits (153), Expect = 1e-07 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -3 Query: 93 RIENDKRTMPVIWHQSLLAFVQRYKNELQKE 1 R END RTMPVIWHQSLLAFVQRYKNELQKE Sbjct: 351 RFENDTRTMPVIWHQSLLAFVQRYKNELQKE 381 >ref|XP_017246132.1| PREDICTED: bystin-like [Daucus carota subsp. sativus] gb|KZN09614.1| hypothetical protein DCAR_002270 [Daucus carota subsp. sativus] Length = 444 Score = 57.8 bits (138), Expect = 8e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 84 NDKRTMPVIWHQSLLAFVQRYKNELQKE 1 ND+RTMPVIWHQSLLAFVQRYKNEL KE Sbjct: 351 NDERTMPVIWHQSLLAFVQRYKNELVKE 378