BLASTX nr result
ID: Astragalus22_contig00033768
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00033768 (325 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNY05027.1| threonine-tRNA ligase mitochondrial-like [Trifoli... 62 9e-09 dbj|GAU36896.1| hypothetical protein TSUD_220650 [Trifolium subt... 62 1e-08 gb|OIV93086.1| hypothetical protein TanjilG_20748 [Lupinus angus... 58 2e-07 ref|XP_019424028.1| PREDICTED: threonine--tRNA ligase, mitochond... 58 2e-07 ref|XP_004489863.1| PREDICTED: threonine--tRNA ligase, mitochond... 58 2e-07 ref|XP_003519592.1| PREDICTED: threonine--tRNA ligase, mitochond... 57 3e-07 gb|KHN00337.1| Threonine--tRNA ligase, mitochondrial [Glycine soja] 57 3e-07 gb|KHN12091.1| Threonine--tRNA ligase, mitochondrial [Glycine soja] 57 4e-07 ref|XP_003613276.1| threonyl-tRNA synthetase/threonine-tRNA liga... 57 4e-07 ref|XP_003517788.1| PREDICTED: threonine--tRNA ligase, mitochond... 57 4e-07 gb|KOM45664.1| hypothetical protein LR48_Vigan06g097000 [Vigna a... 56 8e-07 ref|XP_017427681.1| PREDICTED: threonine--tRNA ligase, mitochond... 56 8e-07 gb|PNX77569.1| threonine-tRNA ligase mitochondrial-like, partial... 56 8e-07 gb|OIV94523.1| hypothetical protein TanjilG_25585 [Lupinus angus... 56 1e-06 ref|XP_019422055.1| PREDICTED: threonine--tRNA ligase, mitochond... 56 1e-06 gb|PNX93089.1| threonine-tRNA ligase mitochondrial-like, partial... 55 1e-06 ref|XP_012571455.1| PREDICTED: threonine--tRNA ligase, mitochond... 55 2e-06 ref|XP_012571454.1| PREDICTED: threonine--tRNA ligase, mitochond... 55 2e-06 ref|XP_012571453.1| PREDICTED: threonine--tRNA ligase, mitochond... 55 2e-06 ref|XP_004500860.1| PREDICTED: threonine--tRNA ligase, mitochond... 55 2e-06 >gb|PNY05027.1| threonine-tRNA ligase mitochondrial-like [Trifolium pratense] Length = 408 Score = 61.6 bits (148), Expect = 9e-09 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +1 Query: 1 IKDEVRNALNFIDYVYQIFGFTYELKLST 87 +KDEVRNALNFIDYVYQIFGFTYELKLST Sbjct: 165 VKDEVRNALNFIDYVYQIFGFTYELKLST 193 >dbj|GAU36896.1| hypothetical protein TSUD_220650 [Trifolium subterraneum] Length = 685 Score = 61.6 bits (148), Expect = 1e-08 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +1 Query: 1 IKDEVRNALNFIDYVYQIFGFTYELKLST 87 +KDEVRNALNFIDYVYQIFGFTYELKLST Sbjct: 442 VKDEVRNALNFIDYVYQIFGFTYELKLST 470 >gb|OIV93086.1| hypothetical protein TanjilG_20748 [Lupinus angustifolius] Length = 690 Score = 58.2 bits (139), Expect = 2e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 1 IKDEVRNALNFIDYVYQIFGFTYELKLST 87 IKDEVRNALNFI+YVY IFGFTYELKLST Sbjct: 447 IKDEVRNALNFINYVYDIFGFTYELKLST 475 >ref|XP_019424028.1| PREDICTED: threonine--tRNA ligase, mitochondrial 1-like [Lupinus angustifolius] Length = 715 Score = 58.2 bits (139), Expect = 2e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 1 IKDEVRNALNFIDYVYQIFGFTYELKLST 87 IKDEVRNALNFI+YVY IFGFTYELKLST Sbjct: 472 IKDEVRNALNFINYVYDIFGFTYELKLST 500 >ref|XP_004489863.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Cicer arietinum] Length = 719 Score = 57.8 bits (138), Expect = 2e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 1 IKDEVRNALNFIDYVYQIFGFTYELKLST 87 IKDEVR ALNFI+YVYQIFGFTYELKLST Sbjct: 476 IKDEVRKALNFINYVYQIFGFTYELKLST 504 >ref|XP_003519592.1| PREDICTED: threonine--tRNA ligase, mitochondrial 1-like [Glycine max] gb|KRH69521.1| hypothetical protein GLYMA_02G032800 [Glycine max] Length = 710 Score = 57.4 bits (137), Expect = 3e-07 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +1 Query: 1 IKDEVRNALNFIDYVYQIFGFTYELKLST 87 IKDEVRN+LNFI+YVY+IFGFTYELKLST Sbjct: 467 IKDEVRNSLNFINYVYKIFGFTYELKLST 495 >gb|KHN00337.1| Threonine--tRNA ligase, mitochondrial [Glycine soja] Length = 725 Score = 57.4 bits (137), Expect = 3e-07 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +1 Query: 1 IKDEVRNALNFIDYVYQIFGFTYELKLST 87 IKDEVRN+LNFI+YVY+IFGFTYELKLST Sbjct: 482 IKDEVRNSLNFINYVYKIFGFTYELKLST 510 >gb|KHN12091.1| Threonine--tRNA ligase, mitochondrial [Glycine soja] Length = 599 Score = 57.0 bits (136), Expect = 4e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 1 IKDEVRNALNFIDYVYQIFGFTYELKLST 87 IKDEVRN LNFI+YVY+IFGFTYELKLST Sbjct: 356 IKDEVRNGLNFINYVYKIFGFTYELKLST 384 >ref|XP_003613276.1| threonyl-tRNA synthetase/threonine-tRNA ligase, putative [Medicago truncatula] gb|AES96234.1| threonyl-tRNA synthetase/threonine-tRNA ligase, putative [Medicago truncatula] Length = 711 Score = 57.0 bits (136), Expect = 4e-07 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +1 Query: 1 IKDEVRNALNFIDYVYQIFGFTYELKLST 87 IKDEVRNALNFID+VY+IFGF+YELKLST Sbjct: 468 IKDEVRNALNFIDHVYKIFGFSYELKLST 496 >ref|XP_003517788.1| PREDICTED: threonine--tRNA ligase, mitochondrial 1-like [Glycine max] gb|KRH74628.1| hypothetical protein GLYMA_01G032500 [Glycine max] Length = 717 Score = 57.0 bits (136), Expect = 4e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 1 IKDEVRNALNFIDYVYQIFGFTYELKLST 87 IKDEVRN LNFI+YVY+IFGFTYELKLST Sbjct: 474 IKDEVRNGLNFINYVYKIFGFTYELKLST 502 >gb|KOM45664.1| hypothetical protein LR48_Vigan06g097000 [Vigna angularis] Length = 682 Score = 56.2 bits (134), Expect = 8e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 1 IKDEVRNALNFIDYVYQIFGFTYELKLST 87 IKDEVRNAL+FI+YVY IFGFTYELKLST Sbjct: 439 IKDEVRNALSFINYVYSIFGFTYELKLST 467 >ref|XP_017427681.1| PREDICTED: threonine--tRNA ligase, mitochondrial 1 [Vigna angularis] dbj|BAT99555.1| hypothetical protein VIGAN_10100700 [Vigna angularis var. angularis] Length = 707 Score = 56.2 bits (134), Expect = 8e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 1 IKDEVRNALNFIDYVYQIFGFTYELKLST 87 IKDEVRNAL+FI+YVY IFGFTYELKLST Sbjct: 464 IKDEVRNALSFINYVYSIFGFTYELKLST 492 >gb|PNX77569.1| threonine-tRNA ligase mitochondrial-like, partial [Trifolium pratense] Length = 282 Score = 55.8 bits (133), Expect = 8e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 1 IKDEVRNALNFIDYVYQIFGFTYELKLSTV 90 IKDEV+ ALNFID VYQIFGFTYELKLST+ Sbjct: 12 IKDEVKKALNFIDDVYQIFGFTYELKLSTI 41 >gb|OIV94523.1| hypothetical protein TanjilG_25585 [Lupinus angustifolius] Length = 688 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +1 Query: 1 IKDEVRNALNFIDYVYQIFGFTYELKLST 87 I+DEVRNALNFI+YVY IFGFTY+LKLST Sbjct: 445 IRDEVRNALNFINYVYDIFGFTYDLKLST 473 >ref|XP_019422055.1| PREDICTED: threonine--tRNA ligase, mitochondrial 1-like [Lupinus angustifolius] Length = 713 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +1 Query: 1 IKDEVRNALNFIDYVYQIFGFTYELKLST 87 I+DEVRNALNFI+YVY IFGFTY+LKLST Sbjct: 470 IRDEVRNALNFINYVYDIFGFTYDLKLST 498 >gb|PNX93089.1| threonine-tRNA ligase mitochondrial-like, partial [Trifolium pratense] Length = 429 Score = 55.5 bits (132), Expect = 1e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +1 Query: 1 IKDEVRNALNFIDYVYQIFGFTYELKLST 87 IKDEV +LNFIDYVYQIFGFTYELKLST Sbjct: 218 IKDEVIKSLNFIDYVYQIFGFTYELKLST 246 >ref|XP_012571455.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like isoform X4 [Cicer arietinum] Length = 426 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +1 Query: 1 IKDEVRNALNFIDYVYQIFGFTYELKLST 87 IKDEV ALNFIDYVYQIFGFTYEL+LST Sbjct: 183 IKDEVIKALNFIDYVYQIFGFTYELQLST 211 >ref|XP_012571454.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like isoform X3 [Cicer arietinum] Length = 451 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +1 Query: 1 IKDEVRNALNFIDYVYQIFGFTYELKLST 87 IKDEV ALNFIDYVYQIFGFTYEL+LST Sbjct: 208 IKDEVIKALNFIDYVYQIFGFTYELQLST 236 >ref|XP_012571453.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like isoform X2 [Cicer arietinum] Length = 480 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +1 Query: 1 IKDEVRNALNFIDYVYQIFGFTYELKLST 87 IKDEV ALNFIDYVYQIFGFTYEL+LST Sbjct: 237 IKDEVIKALNFIDYVYQIFGFTYELQLST 265 >ref|XP_004500860.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like isoform X1 [Cicer arietinum] Length = 508 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +1 Query: 1 IKDEVRNALNFIDYVYQIFGFTYELKLST 87 IKDEV ALNFIDYVYQIFGFTYEL+LST Sbjct: 265 IKDEVIKALNFIDYVYQIFGFTYELQLST 293