BLASTX nr result
ID: Astragalus22_contig00033762
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00033762 (436 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU27629.1| hypothetical protein TSUD_125750 [Trifolium subt... 66 5e-10 ref|XP_003599325.1| cinnamoyl-CoA reductase-like protein [Medica... 64 3e-09 gb|AAY86360.1| cinnamoyl-CoA reductase [Acacia auriculiformis x ... 64 4e-09 ref|XP_016206257.1| cinnamoyl-CoA reductase 1 [Arachis ipaensis] 63 7e-09 ref|XP_015948582.1| cinnamoyl-CoA reductase 1 [Arachis duranensis] 63 7e-09 gb|PNT20156.1| hypothetical protein POPTR_009G076300v3 [Populus ... 62 1e-08 gb|AFK45256.1| unknown [Lotus japonicus] 62 2e-08 ref|XP_002526627.1| PREDICTED: cinnamoyl-CoA reductase 1 [Ricinu... 59 2e-08 gb|AFK44321.1| unknown [Lotus japonicus] 62 2e-08 gb|AFK41619.1| unknown [Lotus japonicus] 62 2e-08 gb|APR63853.1| cinnamoyl-CoA reductase protein 9 [Populus toment... 62 2e-08 gb|AKG06588.1| cinnamoyl-CoA reductase 9 [Populus tomentosa] 62 2e-08 ref|XP_002313227.1| putative cinnamoyl-CoA reductase family prot... 62 2e-08 ref|XP_019439261.1| PREDICTED: cinnamoyl-CoA reductase 1-like [L... 58 3e-08 ref|XP_010257053.1| PREDICTED: cinnamoyl-CoA reductase 1 [Nelumb... 61 3e-08 ref|XP_004500311.1| PREDICTED: cinnamoyl-CoA reductase 1 [Cicer ... 61 5e-08 dbj|GAV66565.1| Epimerase domain-containing protein, partial [Ce... 61 5e-08 gb|ONH99801.1| hypothetical protein PRUPE_6G051200 [Prunus persica] 58 6e-08 ref|XP_007016967.1| PREDICTED: cinnamoyl-CoA reductase 1 [Theobr... 60 6e-08 ref|XP_002526624.1| PREDICTED: cinnamoyl-CoA reductase 1 [Ricinu... 60 9e-08 >dbj|GAU27629.1| hypothetical protein TSUD_125750 [Trifolium subterraneum] Length = 315 Score = 66.2 bits (160), Expect = 5e-10 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +3 Query: 309 LCVEAIRQYGDFVDIVADLYPEYPVVRVPKDKDNGLLRAKNA 434 LCVEAIR Y DFV++V+DLYPEY V ++P DK GLLRAKNA Sbjct: 243 LCVEAIRHYSDFVNLVSDLYPEYNVAKLPTDKQPGLLRAKNA 284 >ref|XP_003599325.1| cinnamoyl-CoA reductase-like protein [Medicago truncatula] gb|AES69576.1| cinnamoyl-CoA reductase-like protein [Medicago truncatula] Length = 319 Score = 64.3 bits (155), Expect = 3e-09 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +3 Query: 309 LCVEAIRQYGDFVDIVADLYPEYPVVRVPKDKDNGLLRAKNA 434 LCVEAIR Y DFV++VA+LYPEY V ++P D GLLRAKNA Sbjct: 247 LCVEAIRHYSDFVNLVAELYPEYNVAKIPTDTQPGLLRAKNA 288 >gb|AAY86360.1| cinnamoyl-CoA reductase [Acacia auriculiformis x Acacia mangium] gb|ADQ53455.1| cinnamoyl-CoA reductase [Acacia auriculiformis x Acacia mangium] Length = 319 Score = 63.9 bits (154), Expect = 4e-09 Identities = 31/50 (62%), Positives = 37/50 (74%) Frame = +3 Query: 285 RKEELREVLCVEAIRQYGDFVDIVADLYPEYPVVRVPKDKDNGLLRAKNA 434 +KE LCVEAIR YGDFV+ VA+LYP+Y V +VPKD GLLRA +A Sbjct: 239 KKEASGRNLCVEAIRHYGDFVEKVAELYPQYHVAKVPKDTQPGLLRATDA 288 >ref|XP_016206257.1| cinnamoyl-CoA reductase 1 [Arachis ipaensis] Length = 319 Score = 63.2 bits (152), Expect = 7e-09 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +3 Query: 309 LCVEAIRQYGDFVDIVADLYPEYPVVRVPKDKDNGLLRAKNA 434 LCVEAIR YGDFV VA+LYPEY V ++PKD GLLRAK+A Sbjct: 247 LCVEAIRHYGDFVAKVAELYPEYNVAKLPKDTQPGLLRAKDA 288 >ref|XP_015948582.1| cinnamoyl-CoA reductase 1 [Arachis duranensis] Length = 319 Score = 63.2 bits (152), Expect = 7e-09 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +3 Query: 309 LCVEAIRQYGDFVDIVADLYPEYPVVRVPKDKDNGLLRAKNA 434 LCVEAIR YGDFV VA+LYPEY V ++PKD GLLRAK+A Sbjct: 247 LCVEAIRHYGDFVAKVAELYPEYNVAKLPKDTQPGLLRAKDA 288 >gb|PNT20156.1| hypothetical protein POPTR_009G076300v3 [Populus trichocarpa] Length = 239 Score = 61.6 bits (148), Expect = 1e-08 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = +3 Query: 309 LCVEAIRQYGDFVDIVADLYPEYPVVRVPKDKDNGLLRAKN 431 LCVEAI YGDFV VA+LYPEY + R+PKD GLLRAKN Sbjct: 166 LCVEAISHYGDFVAKVAELYPEYKIPRLPKDTQPGLLRAKN 206 >gb|AFK45256.1| unknown [Lotus japonicus] Length = 256 Score = 61.6 bits (148), Expect = 2e-08 Identities = 31/42 (73%), Positives = 32/42 (76%) Frame = +3 Query: 309 LCVEAIRQYGDFVDIVADLYPEYPVVRVPKDKDNGLLRAKNA 434 LCVEAIR Y DFV +VADLYPEY VVRV KD LLRA NA Sbjct: 188 LCVEAIRHYSDFVAMVADLYPEYNVVRVTKDTQPELLRANNA 229 >ref|XP_002526627.1| PREDICTED: cinnamoyl-CoA reductase 1 [Ricinus communis] gb|EEF35786.1| cinnamoyl-CoA reductase, putative [Ricinus communis] Length = 100 Score = 58.5 bits (140), Expect = 2e-08 Identities = 28/41 (68%), Positives = 31/41 (75%) Frame = +3 Query: 309 LCVEAIRQYGDFVDIVADLYPEYPVVRVPKDKDNGLLRAKN 431 LCVEAI YGDFV V +LYPEY V R+PKD GLLRAK+ Sbjct: 27 LCVEAISHYGDFVAKVVELYPEYKVPRLPKDTQPGLLRAKD 67 >gb|AFK44321.1| unknown [Lotus japonicus] Length = 319 Score = 61.6 bits (148), Expect = 2e-08 Identities = 31/42 (73%), Positives = 32/42 (76%) Frame = +3 Query: 309 LCVEAIRQYGDFVDIVADLYPEYPVVRVPKDKDNGLLRAKNA 434 LCVEAIR Y DFV +VADLYPEY VVRV KD LLRA NA Sbjct: 247 LCVEAIRHYSDFVAMVADLYPEYNVVRVTKDTQPELLRANNA 288 >gb|AFK41619.1| unknown [Lotus japonicus] Length = 319 Score = 61.6 bits (148), Expect = 2e-08 Identities = 31/42 (73%), Positives = 32/42 (76%) Frame = +3 Query: 309 LCVEAIRQYGDFVDIVADLYPEYPVVRVPKDKDNGLLRAKNA 434 LCVEAIR Y DFV +VADLYPEY VVRV KD LLRA NA Sbjct: 247 LCVEAIRHYSDFVAMVADLYPEYNVVRVTKDTQPELLRANNA 288 >gb|APR63853.1| cinnamoyl-CoA reductase protein 9 [Populus tomentosa] Length = 323 Score = 61.6 bits (148), Expect = 2e-08 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = +3 Query: 309 LCVEAIRQYGDFVDIVADLYPEYPVVRVPKDKDNGLLRAKN 431 LCVEAI YGDFV VA+LYPEY + R+PKD GLLRAKN Sbjct: 250 LCVEAISHYGDFVAKVAELYPEYKIPRLPKDTQPGLLRAKN 290 >gb|AKG06588.1| cinnamoyl-CoA reductase 9 [Populus tomentosa] Length = 323 Score = 61.6 bits (148), Expect = 2e-08 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = +3 Query: 309 LCVEAIRQYGDFVDIVADLYPEYPVVRVPKDKDNGLLRAKN 431 LCVEAI YGDFV VA+LYPEY + R+PKD GLLRAKN Sbjct: 250 LCVEAISHYGDFVAKVAELYPEYKIPRLPKDTQPGLLRAKN 290 >ref|XP_002313227.1| putative cinnamoyl-CoA reductase family protein [Populus trichocarpa] gb|PNT20158.1| hypothetical protein POPTR_009G076300v3 [Populus trichocarpa] Length = 323 Score = 61.6 bits (148), Expect = 2e-08 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = +3 Query: 309 LCVEAIRQYGDFVDIVADLYPEYPVVRVPKDKDNGLLRAKN 431 LCVEAI YGDFV VA+LYPEY + R+PKD GLLRAKN Sbjct: 250 LCVEAISHYGDFVAKVAELYPEYKIPRLPKDTQPGLLRAKN 290 >ref|XP_019439261.1| PREDICTED: cinnamoyl-CoA reductase 1-like [Lupinus angustifolius] Length = 99 Score = 58.2 bits (139), Expect = 3e-08 Identities = 28/41 (68%), Positives = 31/41 (75%) Frame = +3 Query: 309 LCVEAIRQYGDFVDIVADLYPEYPVVRVPKDKDNGLLRAKN 431 LCVEAIR YGD V VA+LYPEY V +PKD GLLRAK+ Sbjct: 27 LCVEAIRHYGDLVAKVAELYPEYNVATLPKDTQPGLLRAKD 67 >ref|XP_010257053.1| PREDICTED: cinnamoyl-CoA reductase 1 [Nelumbo nucifera] Length = 326 Score = 61.2 bits (147), Expect = 3e-08 Identities = 30/42 (71%), Positives = 31/42 (73%) Frame = +3 Query: 309 LCVEAIRQYGDFVDIVADLYPEYPVVRVPKDKDNGLLRAKNA 434 LCVEAI YGDF VA+LYPEY V R PKD GLLRAKNA Sbjct: 253 LCVEAISHYGDFAAKVAELYPEYKVPRFPKDTQPGLLRAKNA 294 >ref|XP_004500311.1| PREDICTED: cinnamoyl-CoA reductase 1 [Cicer arietinum] Length = 319 Score = 60.8 bits (146), Expect = 5e-08 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +3 Query: 309 LCVEAIRQYGDFVDIVADLYPEYPVVRVPKDKDNGLLRAKNA 434 LCVEAIR YGDFV +VA+LYPEY V +PK+ GLLR+K+A Sbjct: 247 LCVEAIRHYGDFVALVAELYPEYNVATLPKNTQPGLLRSKDA 288 >dbj|GAV66565.1| Epimerase domain-containing protein, partial [Cephalotus follicularis] Length = 325 Score = 60.8 bits (146), Expect = 5e-08 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = +3 Query: 309 LCVEAIRQYGDFVDIVADLYPEYPVVRVPKDKDNGLLRAKN 431 LCVEAI YGDFV VA+LYPEY + R+PKD GLLRAKN Sbjct: 252 LCVEAISHYGDFVAKVAELYPEYELPRLPKDTQPGLLRAKN 292 >gb|ONH99801.1| hypothetical protein PRUPE_6G051200 [Prunus persica] Length = 119 Score = 57.8 bits (138), Expect = 6e-08 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = +3 Query: 309 LCVEAIRQYGDFVDIVADLYPEYPVVRVPKDKDNGLLRAKN 431 LCVEAI YGDFV VA+LYPEY V +PKD GLLR KN Sbjct: 46 LCVEAISHYGDFVAKVAELYPEYKVPSLPKDTQPGLLREKN 86 >ref|XP_007016967.1| PREDICTED: cinnamoyl-CoA reductase 1 [Theobroma cacao] gb|EOY34586.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao] Length = 323 Score = 60.5 bits (145), Expect = 6e-08 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = +3 Query: 309 LCVEAIRQYGDFVDIVADLYPEYPVVRVPKDKDNGLLRAKN 431 LCVEAI YGDFV VA+LYPEY V R+P+D GLLRAKN Sbjct: 250 LCVEAISHYGDFVAKVAELYPEYNVPRLPRDTQPGLLRAKN 290 >ref|XP_002526624.1| PREDICTED: cinnamoyl-CoA reductase 1 [Ricinus communis] gb|EEF35783.1| cinnamoyl-CoA reductase, putative [Ricinus communis] Length = 323 Score = 60.1 bits (144), Expect = 9e-08 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = +3 Query: 309 LCVEAIRQYGDFVDIVADLYPEYPVVRVPKDKDNGLLRAKN 431 LCVEAI YGDFV VA+LYPEY V R+PKD GLLRAK+ Sbjct: 250 LCVEAISHYGDFVAKVAELYPEYKVPRLPKDTQPGLLRAKD 290